ÿþM icrosoft W ord - th é sekrantar

publicité
REPUBLIQUE ALGERIENNE DEMOCRATIQUE ET POPULAIRE
MINISTERE DE L’ENSEIGNEMENT SUPERIEUR
ET DE LA RECHERCHE SCIENTIFIQUE
UNIVERSITE D’ORAN, ES-SENIA
FACULTE DES SCIENCES
DEPARTEMENT DE BIOLOGIE
MEMOIRE
Présenté par :
Mr. Kamel KRANTAR
Pour obtenir
LE DIPLOME DE MAGISTER
Spécialité: Microbiologie
Option : Microbiologie Alimentaire
Intitulé :
Caractérisation génétique du métabolisme du citrate chez
Leuconostoc mesenteroides subsp. cremoris 195.
Soutenue le :
23 Janvier 2007
Devant les membres du jury :
Pr.AOUES Abdelkader
Professeur à l’Université d’Oran, Es-Sénia, Algérie.
(Président)
Dr.CHEKROUN Abdellah Maître de conférence à l’Université d’Oran, Es-Sénia, Algérie.
(Examinateur)
Dr.KACEM Mourad
Maître de conférence à l’Université d’Oran, Es-Sénia, Algérie.
(Examinateur)
Pr.BENSOLTANE Ahmed Professeur à l’Université d’Oran, Es-Sénia, Algérie.
(Encadreur)
Dr.DRIDER Djamel
Maître de conférence à l’ENITIAA., Nantes, France.
(Co-encadreur)
1
REMERCIEMENTS
J’exprime ma profonde reconnaissance au Professeur Ahmed
BENSOLTANE qui m’a accueilli dans son équipe au sein de son laboratoire de
Microbiologie Alimentaire et Industrielle à l’Université d’Oran et d’accepter
de diriger ce travail. Ses conseils, ses encouragements et sa confiance m’ont
beaucoup stimulé dans la réalisation de ce mémoire de Magister.
Je tiens à remercier aussi le Professeur Charles DIVIES, Directeur
du Laboratoire de Microbiologie UMR INRA, ENSBANA à l’Université de
Bourgogne, Dijon, France, qui m’a permis de réaliser ce travail de recherche
en m’accueillant au sein de son Laboratoire.
Je remercie vivement Monsieur Djamel DRIDER, Maître de conférence
à l’ENITIAA., Nantes, France, pour sa rigueur scientifique et pour avoir coencadrer ce travail.
Je remercie infiniment le Professeur AOUES Abdelkader, le Docteur
CHEKROUN Abdellah et le Docteur KACEM Mourad pour avoir accepté de
lire et de juger ce travail.
Mes remerciements vont également à tous les membres des deux
laboratoires où ce travail a été réalisé qui par leur aide scientifique, technique
et administrative, ont contribué au bon déroulement de ce travail.
2
SOMMAIRE
INTRODUCTION
REVUE BIBLIOGRAPHIQUE
1
I/ Généralités sur les bactéries lactiques.
3
I-1 Lactococcus
5
I-2 Lactobacillus
6
I-3 Leuconostoc
6
II/ Le métabolisme de l’acides citrique.
11
II.1. Protéines impliquées dans le métabolisme anaérobie du citrate.
12
II.2. Le métabolisme du citrate chez les bactéries lactiques.
19
II.2.1. Le cométabolisme sucre/citrate chez Leuconostoc.
21
II.2.2. Mécanismes du transport du citrate chez les bactéries lactiques.
22
II.2.3. Citrate lyase et Oxaloacétate décarboxylase des bactéries lactiques.
24
III/ Génétique de la fermentation du citrate chez les bactéries.
25
III-1. Chez les entérobactéries
25
III-1-1. Klebseilla pneumoniae,
25
III-1-2. Escherichia coli.
26
III-2. Chez les bactéries lactiques.
28
III-2-1. Chez Lactococcus lactis
28
III-2-2. Chez Weissella paramesenteroides
31
III-2-3. Chez Leuconostoc mesenteroides subsp. cremoris 195
31
MATERIELS ET METHODES
32
Partie étude microbiologique
32
I. Les souches de bactéries lactiques utilisées.
32
II. Milieux de culture.
32
II. 1. MRS
32
II. 2. M17
32
II. 3. KmK
32
III. Fermentation des sucres
32
IV. Conservation des souches.
33
V. Réactivation et purification des souches
33
V. 1. Réactivation des souches
33
V. 2. Purification
33
VI. Caractérisation des souches
33
3
Partie étude génétique
34
I. Souches bactériennes, milieux de culture, enzymes et oligonucléotides.
34
II. Techniques d’extraction et de purification des acides nucléiques
35
1. Extraction et purification de l’ADN
35
2. Amplification de l’ADN
36
3. Restriction et ligation
37
4. Extraction de l’ARN total
37
III. Techniques de manipulation et d’analyse des acides nucléiques.
39
1. Southern Blot
39
2. Norther Blot
41
3. Hybridation
41
IV. Séquençage de l’ADN.
42
V. utilisation du citrate par des cellules non proliférantes (resting cells).
42
RESULTATS
43
Etude microbiologique
43
I. Aspect morphologique
43
II. Aspect physiologique
43
III. Test des galeries Api 50 CH
43
IV. Co-métabolisme sucre citrate chez Lmc 195
45
V. Utilisation du citrate par des cellules non proliférantes.
45
Etude génétique
46
I. Séquençage et Analyse de la partie en aval du locus citCDEFG
46
I. 1. Clonage et Séquençage
46
I. 2. Analyse des séquences nucléotidiques.
48
II. Comparaison des séquences protéiques.
51
II. 1. Alignement de la séquence protéique CitO
51
II. 2. Alignement de la séquence protéique CitP
51
III. Caractérisation de la citrate perméase de Lmc 195
54
III. 1. Localisation de la citrate perméase de Lmc 195
54
III. 2. Expression hétérologue de citP chez Lactococcus lactis subsp. lactis IL1403
55
Construction du plasmide pGID075
55
IV. Analyse transcriptionelle
57
4
DISCUSSION
59
 Description d’un premier transporteur de citrate à localisation chromosomique
chez une bactérie lactique.
59
 Organisation des gènes de la fermentation du citrate chez les bactéries
60
 Discussion du rôle de citO dans le métabolisme du citrate chez Lmc 195
62
CONCLUSION
64
PERSPECTIVES
64
REFERENCES BIBLIOGRAPHIQUES
65
ACTIVITES SCIENTIFIQUES
Articles
Communications scientifiques
Séquences nucléiques déposées chez la banque génomique EMBL
ANNEXE
Composition des milieux de culture
RESUME/ABSTRACT
5
ABREVIATIONS
ACP : Acyl Carrier Protein.
als:  acétolactate synthase.
BrET : Bromide d’Ethidium.
CL : citrate lyase.
DTT: Dithiothreitol.
E. coli : Escherichia coli.
EDTA: Ethylenediaminetetra-acetate (Acide édétique).
IS : Insertion sequence (Séquence d’insertion).
Kb: Kilobase.
kDa: KiloDalton.
Lmc: Leuconostoc mesenteroides subsp. cremoris.
Lmm : Leuconostoc mesenteroides subsp. mesenteroides.
O/N : Over Night.
ORF : Open Reading Frame (Phase ouverte de lecture).
PCR: Polymerase Chain Reaction (Amplification en chaîne par polymérase).
RBS : Ribosomal Binding Site (Site de fixation ribosomale).
RF: RNase Free.
RT PCR: Reverse Transcriptase PCR (PCR avec l’enzyme reverse transcriptase).
SDS: Sodium Dodecyl Sulfate (sodium lauryl sulfate)
SSC: NaCl-Sodium Citrate.
TAE : Tris-Acetate-EDTA (Hydroxyméthyle-Acétate-Acide édétique).
TES: Tris-EDTA-NaCl.
TGE: Tris-Glucose-EDTA.
TPP: Thiamine PyroPhosphate.
6
Liste des tableaux
Tableau 1 : Les différents genres des bactéries lactiques utilisées dans l’industrie agroalimentaire (Novel, 1993).
Tableau 2: Caractères de différenciation des espèces de Lactococcus ssp. et Streptococcus
thermophilus d’intérêt laitier (Sandine, 1988).
Tableau 3: Quelques caractères distinctifs des Lactobacillus (Leveau et al., 1991).
Tableau 4: Les caractères distinctifs des espèces du genre Leuconostoc (Garvie, 1986).
Tableau 5 : Teneur en Leuconostocs de quelques fromages français fabriqués à partir de lait
cru (Devoyod et Poullain, 1988).
Tableau 6 : Caractérisation fonctionnelle des systèmes de transport chez les bactéries.
Tableau 7 : Localisation des gènes du transport du citrate chez les bactéries et caractérisation
de leurs produits.
Tableau 8 : Souches, enzymes, oligonucléotides et plasmides utilisés dans cette étude.
Tableau 9: Résultats de la galerie Api 50 CH et des tests classiques de caractérisation.
Tableau 10 : Expression hétérologue chez la souche Lactococcus lactis subsp. lactis IL1403
Tableau 11: Les activités spécifiques de la Citrate Lyase et la Lactate Déshydrogénase
(U/mg).
Tableau 12: Localisation des gènes du transport du citrate chez les bactéries lactiques
étudiées.
7
Liste des figures
Figure 1 : Fermentation hétérolactique et homolactique chez les bactéries lactiques
(Desmazeaud et De Roissart, 1994).
Figure 2 : Photos de (A) Leuconostoc mesenteroides et (B) Oenococcus œni au microscope
électronique. (Lonvaud-Funel, 1999).
Figure 3 : voies de fermentation du citrate chez (A) Klebseilla pneumoniae (O’Brien et Stern,
1969), (B) E. coli (Lütgens et Gottschalk, 1980), (C) Providencia regtteri (Kröger, 1974) et
(D) Clostridium sphenoides (Antranikiane et Gottschalk, 1989).
Figure 4 : Modèle pour le transport du citrate à travers la membrane, via CitS chez Klebseilla
pneumoniae (Lolkema et al., 1994 ; Van Der Rest et al., 1992).
Figure 5 : Modèle pour le transport du citrate à travers la membrane, via CitH chez Klebseilla
pneumoniae (Van Der Rest et al., 1992).
Figure 6 : Fonctionnement de la citrate lyase chez Klebsiella pneumoniae (Bott et Dimroth,
1994).
Figure 7 : Mécanisme du fonctionnement de l’Oxaloacétate décarboxylase chez Klebsiella
pneumoniae (Dimroth et Thomer, 1993).
Figure 8 : Principales étapes du métabolisme du citrate par les bactéries lactiques (Diviès et
al., 1994).
Figure 9 : Métabolisme du glucose (A) et du co-métabolisme du glucose/citrate (B) chez
Leuconostoc (Marty-Teysset et al., 1996).
Figure 10 : Schéma représentatif du mécanisme de la génération de la force proton motrice
par la fermentation citrolactique chez Leuconostoc mesenteroides (Bandell et al., 1998).
Figure 11: Schéma représentatif du mécanisme de la fermentation du citrate et de l’extrusion
du lactate chez Lactococcus lactis (Magni et al., 1999).
Figure 12 : Organisation des gènes de la fermentation du citrate chez Klebseilla pneumoniae
(Meyer et al., 1997).
Figure 13 : Organisation des gènes de la fermentation du citrate chez Escherichia coli
(Blattner et al., 1997).
Figure 14 : Organisation génétique de la région en amont de citP chez Lactococcus lactis
biovar. diacetylactis sur le plasmide pCIT264 (Lopez de Felip et al., 1995).
Figure 15 : Organisation des gènes de l’opéron citrate chez Weissella paramesenteroides
(Martin et al., 1999).
Figure 16 : Organisation des gènes du locus citrate lyase chez Leuconostoc mesenteroides
subsp. cremoris 195 (Bekal et al., 1998).
Figure 17 : (A) photo d’une galerie Api 50 CH (Pour illustration) ; (B) légende des sucres
utilisés dans la galerie Api 50 CH.
Figure 18 : Schéma explicatif du principe de la PCR (Polymearse Chain Reaction).
Figure 19 : Courbe de croissance de Lmc 195 sur MRS avec induction par le citrate.
Figure 20 : Métabolisme du citrate par des cellules non proliférantes de Lmc 195.
8
Figure 21 : Principe de la technique de PCR inverse (Technique utilisée au Laboratoire de
Microbiologie Alimentaire de l’ENSBANA, Université de Bourgogne. France.)
Figure 22 : Séquence nucléotidique et séquence en acides aminés déduite du gène citO et la
séquence complète du gène citP chez Leuconostoc mesenteroides subsp. cremoris 195.
Figure 23 : Alignement multiple des lipases/estérases de différents microorganismes avec la
protéine CitO de Leuconostoc mesenteroides subsp. cremoris 195.
Figure 24 : Alignement de la citrate perméase des bactéries lactiques.
Figure 25: Comparaison des profils d’hydrophodicité de la CitP de Lmm et la séquence
partielle de CitP de Lmc selon la méthode de Hoop et Woods (1981).
Figure 26 : Profil de l’ADN plasmidique et de l’ADN total de Leuconostoc mesenteroides
subsp. cremoris 195 (A) et Hybridation avec la sonde citP de la même souche.
Figure 27 : Profil de l’ADN plasmidique natif et digéré de Leuconostoc mesenteroides subsp.
mesenteroides 19D (A) et Hybridation avec la sonde citP de Leuconostoc cremoris 195 (B).
Figure 28: Construction du plasmide pGID075 selon la technique décrite par Elagöz et al.,
(1996).
Figure 29 : Northern blot l’ARN a été hybridé avec les sondes 1 et 2 localisées sur les
fragments maecitCDE et citGOP respectivement où M est le marqueur d’ARN 0,24-9,5 kb
Figure 30 : Organisation génétique et transcriptionnelle des gènes du métabolisme du citrate
chez Leuconostoc mesenteroides subsp. cremoris 195. Les sondes 1 et 2 sont utilisées pour le
Northern blot
Figure 31 : Organisation des gènes du métabolisme du citrate chez différentes espèces
bactériennes.
Figure 32 : Schéma représentant l'hypothèse du rôle de CitO dans l’activité citrate lyase.
9
INTRODUCTION
Les bactéries lactiques présentent un grand intérêt biotechnologique. Elles sont largement
utilisées dans des procédés d’élaboration de produits alimentaires. En industrie laitière, les
bactéries du genre Leuconostoc jouent un rôle important grâce à leurs propriétés
métaboliques, principalement la production de CO2 et la synthèse de diacétyle.
La production du CO2 par Leuconostoc provient de l’hétérofermentation du lactose et de
l’utilisation du citrate. Dans la technologie des fromages à pâtes persillées, le CO2 produit est
à l’origine de la formation des cavités dans le caillé, qui seront ensuite peuplées par le
Penicillium. Le diacétyle, dont le citrate est le précurseur, constitue le principal composé
aromatique recherché dans les produits laitiers frais comme le beurre, le fromage frais et la
crème fraîche. Cependant, d’autres composés issus de l’hétérofermentation tels que l’acétate
et l’éthanol contribuent à la texture et à la flaveur de ces produits laitiers.
Chez les bactéries lactiques, le transport du citrate dans la cellule à travers la membrane est
assuré par une citrate perméase (Harvey et Collins, 1962). Une fois dans la cellule, le citrate
est clivé en acétate et oxaloacétate par une citrate lyase. L’oxaloacétate est décarboxylé en
pyruvate qui est transformé en diacétyle par le biais d’une série de réactions intermédiaires
(Kempler et Mac kay, 1981).
Le pool du pyruvate, disponible pour les voies de synthèse du diacétyle, dépend de
l’activité des enzymes impliquées dans la bioconversion du citrate en pyruvate; le flux de
carbone vers le pyruvate peut être modulé en jouant sur le niveau d’expression de la citrate
perméase (Bourel et al., 1996). Il est à noter aussi que le maintient du gradient de
concentration dépend de la vitesse de disparition du citrate dans le milieu intracellulaire, donc
de l’activité de la Citrate Lyase (dégradation du citrate en oxaloacétate et acétate) et de
l’oxaloacétate décarboxylase (décarboxylation de l’oxaloacétate en pyruvate). L’activité de la
citrate lyase est inductible par le citrate et disparaît rapidement après épuisement de ce dernier
dans le milieu (Bekal et al., 1998). En revanche, chez Lactococcus lactis subsp. diacetylactis
la citrate lyase est constitutive (Harvey et Collins, 1961 ; Huguenholtz et Starrenburg, 1992).
Les données physiologiques sur l’oxaloacétate décarboxylase des bactéries lactiques,
montrent que son activité est constitutive chez Lactococcus et inductible par le citrate chez
Leuconostoc (Harvey et al., 1961 ; Mellerick et Cogan, 1981).
Les premières recherches réalisées sur le métabolisme de l’acide citrique ont débuté par
l’étude du cycle des acides tricarboxyliques chez les bactéries aérobies facultatives (Vander
Rest et al., 1991 ; Shimamoto et al., 1991). L’espèce la plus étudiée est Klebsiella
10
pneumoniae. Les gènes du transport et du métabolisme anaérobie du citrate ont été
caractérisés ; les mécanismes de fonctionnement de leurs produits d’expression sont en partie
élucidés (Ishiguro et al., 1988 ; Lolkema et al., 1994 ; Pos et al., 1998).
Chez les bactéries lactiques le métabolisme du citrate a fait l’objet de nombreuses études
chez les genres Leuconostoc et Lactococcus (Cogan, 1987; Schmit et al., 1990; Diviès, 1991).
Les études physiologiques ont mis en évidence l’importance des facteurs environnementaux
tels que le pH, la concentration en sucre, en citrate et en oxygène comme étant des paramètres
influants sur la synthèse des composés aromatiques par ces bactéries lactiques. Le mécanisme
du transport du citrate est particulièrement bien établi chez ces deux genres bactériens. Chez
Leuconostoc mesenteroides ssp. mesenteroides, le transport du citrate à travers la membrane
se fait par échange d’anions lactate produits lors du cométabolisme sucre citrate contre la
forme dianionique du citrate (Hcit2-) (Bandell et al.,1998).
Les gènes codant pour la citrate perméase (citP) localisés sur des plasmides de 7,9 kb chez
Lactococcus lactis subsp. lactis biovar diacetylactis et 23 kb chez Leuconostoc mesenteroides
subsp. mesenteroides (Kempler et Mac kay, 1981 ; Lin et al.,1991) ont été clonés et
caractérisés (Lhotte et al., 1995). Chez ces souches, le phénotype citrate est un caractère
instable lié à la perte du plasmide citrate (Sinha, 1990 ; Kihal et al., 1996), exception faite
pour Leuconostoc mesenteroides subsp. cremoris où les mutants citrate négatif redeviennent
spontanément citrate positif et aucun signale d’hybridation n’a été obtenu en utilisant les
gènes citP connus comme sonde (Kihal et al., 1996).
Les recherches réalisées dans notre laboratoire ont permis la caractérisation de 7 gènes
impliqués dans le métabolisme de l'acide citrique chez Leuconostoc mesenteroides subsp.
cremoris 195. Ces gènes sont regroupés sur le chromosome et appartiennent au locus: clyRmae-citCDEFG (Bekal et al., 1998).
La maîtrise de la fermentation du citrate implique non seulement une meilleure
compréhension des voies métaboliques du citrate et des mécanismes des enzymes impliquées,
mais surtout les mécanismes moléculaires qui contrôlent ces voies. Notre travail s'inscrit dans
le cadre d'une meilleure compréhension du métabolisme du citrate chez Leuconostoc
mesenteroides subsp. cremoris. La finalité de cette recherche est d’identifier les mécanismes
moléculaires et d’utiliser par la suite ces connaissances afin d’améliorer les performances
technologiques des souches. Donc notre projet de recherche concerne : L’étude de la stabilité
du caractère citrate chez Leuconostoc mesenteroides subsp. cremoris (citrate perméase) et la
régulation transcriptionnelle des gènes impliqués dans le métabolisme du citrate chez
Leuconostoc mesenteroides subsp. cremoris.
11
REVUE BIBLIOGRAPHIQUE
12
I. GENERALITES SUR LES BACTERIES LACTIQUES.
Le groupe des bactéries lactiques englobe un ensemble de micro-organismes,
morphologiquement hétérogène, caractérisées par leur capacité à fermenter les glucides en
produisant de l’acide lactique D(-), L(+), DL. Selon (Orla-Jensen, 1919), La fermentation est
dite homolactique si l’acide lactique est pratiquement le seul produit formé et hétérolactique si
d’autres composés sont aussi présents (acide acétique, éthanol, CO2, etc...). D’autre part les
bactéries sont dites : homofermentaires si elles empruntent dans le métabolisme glucidique la
voie d’Embden Meyerhof Parnas de telle sorte que l’acide lactique soit le seul produit final,
par contre, si elles réalisent la voie des Pentoses phosphates elles sont donc
hétérofermentaires
(Leveau
et
al.,1991).
Les
bactéries
lactiques
présentent
des
caractéristiques communes qui expliquent leur regroupement.
Ce sont des bactéries Gram (+), généralement immobiles, non sporulées, catalase et
oxydase négatives et généralement nitrate réductase négative. Anaérobies facultatives, miroaerophiles, capables de fermentation en aérobiose comme en anaérobiose, elles sont aussi
dépourvues de cytochromes et inaptes à toute respiration aérobie ou anaérobie. Toute leur
énergie vient de la fermentation. Elles sont chimio-organotrophes, poly-auxotrophes pour
divers acides aminés, bases nucléiques, vitamines, acides gras, ce qui explique leur faible
capacité de biosynthèse. Leur pH optimal de croissance est environ 5,5. (Novel, 1993).
Bien qu’elles servent à des nombreux procédés concernant l’industrie laitiere et agroalimentaire, les bactéries lactiques habitent de nombreux milieux qui peuvent être
probablement leur réservoir naturel (Desmazeaud, 1992; Novel, 1993). Les bactéries lactiques
du lait proviennent de l’organisme de l’animal producteur (vaches, brebis, chèvres et
chamelles) ou des plantes. De nombreuses souches de Lactococcus, Lactobacillus et
Leuconostoc ont été isolées à partir de différents laits de vaches, brebis et chèvres.
(Cheriguene et al., 2006 ; Chougrani et al., 2006 ; Rouissat et Bensoltane, 2006).
Les espèces du genres Streptococcus, Lactococcus ou Leuconostoc, peuvent être isolées
chez l’homme, chez les animaux, chez les oiseaux, de la peau et du poil des animaux, des
matières fécales, des poussières, de l’ensilage du foin, des grains et des ustensiles de
domiciles et industriels en quantités considérables (Petransxiene et Lapied, 1981;
Desmazeaud, 1992).
Les lactocoques comme les streptocoques du groupe N non pathogène peuvent être isolés
du lait et des végétaux. Lactococcus lactis subsp lactis est facilement isolée du lait cru et des
végétaux par contre Lactococcus lactis subsp cremoris est exclusivement isolée du lait
(Guiraud et Galzy, 1980).
13
Les leuconostocs habitent plusieurs milieux: Lait et produits laitiers, fruits et légumes en
particulier la betterave d’où leur ancien nom Betacoccus (Leveau et Bouix, 1991). On les
isole même des produits de panification, des solutions visqueuses dans les sucreries tandis que
l’espèce Leuconostoc oenos ne peut être isolée que du vin (Larpent et al., 1990; Novel,
1993).
Les espèces mésophiles qui ont un large spectre de fermentation sont présentes dans le lait,
laits fermentés, fromages, végétaux fermentés; on les isole également du vin, de la bière, des
produits de panification et mêmes des viandes fraîches ou fermentées (Petransxiene et Lapied,
1981; Desmazeaud, 1992). Par contre on remarque que les espèces thermophiles qui sont
caractérisées par un spectre d’acidification étroit peuvent être obtenues des laits fermentés,
yaourt, lait traité par la chaleur et certains fromages à des températures dépassant 40°C
(Novel, 1993). Dans le genre Lactobacillus l’espèce Lactobacillus acidophilus colonise
l’intestin de l’homme et des animaux, de nature, elle résiste à des pH très bas, ainsi qu’aux
sels biliaires. (Desmazeaud, 1992). Enfin les espèces du genre Pediococcus ne peuvent être
isolée qu’à partir des végétaux et rarement des vins, bières et parfois des laits fermentés
(Desmazeaud, 1992; Novel, 1993).
Groupe hétérogène, les bactéries lactiques sont représentées par plusieurs genres
d’importance différente. Deux types de morphologies se distinguent (Tableau 1):
1/ Les cocci (0,5 à 1,5 m de diamètre) qui comprennent les leuconostocs, les lactocoques
et les pediocoques (De Roissart, 1986).
2/ Les bacilles (0,5 à 2 m de diamètre et 1,5 à 10 m de longueur) comprenant les
lactobacilles.
Tableau 1. Les différents genres des bactéries lactiques utilisées dans l’industrie agroalimentaire (Novel, 1993)
Cellules
Streptococcus
Leuconostoc
Pediococcus
Lactobacillus
Bifidobacterium
Formes
coque
coque
coque
bacille
variée
arrangement
chaînes
chaînes
tétrades
chaînes
variée
Fermentation
ADN
GC%
homolactique
hétérolactique
homolactique
homo- hétéro lactique
acétique et lactique
34-46
36-43
34-42
32-53
55-67
Ils se distinguent en plus par leur type de fermentation qui peut être un critère de
classification. On trouve :
14
Figure 1 : Fermentation hétérolactique et homolactique chez les bactéries lactiques
(Desmazeaud et De Roissart, 1994).
15
1/ Les homofermentaires, pour lesquels l’acide lactique représente 90% du lactose
fermenté. Tous les lactocoques et une partie des lactobacilles ainsi que tous les pediocoques
peuvent être rattachés à ce groupe.
2/ Les hétérofermentaires, qui fermentent le lactose en acide lactique 50 % avec production
d’une importante quantité de CO2 ; les leuconostocs et l’autre partie des lactobacilles
appartiennent à ce groupe (Tableau 1).
Il y a aussi une différence si on considère le critère de la température optimale de
croissance comme un élément de distinction on aura alors.
1/ Les bactéries mésophiles, ayant une croissance optimale aux températures voisines de 20°c
et 30°C.
2/ Les bactéries thermophiles, avec une croissance optimale aux températures voisines de
40°c à 45°C.
A tous ces genres (Lactococcus, Leuconostoc, Pediococcus, Lactobacillus), a été ajouté le
genre Bifidobacterium (Scardovi, 1986). Récemment, des souches de Bifidobacteries ont été
utilisées comme ferments lactiques en associations avec des souches de Lacobacillus ssp. et
de Streptococcus thermophilus dans différents types de laits. (Chekroun et al., 2006 ; Hadadji
et Bensoltane, 2006 ; Mahi et al., 2006).
Cette classification peut être mieux affinée si on considère le pourcentage en base (GC%)
de l’ADN des espèces qui permet de connaître l’homogénéité des genres. Le pourcentage du
GC% de l’ADN montre une composition assez proche chez les genres Streptococcus (3436%), Leuconostoc (36-43%) et Pediococcus (34-42%) (Farrow et Collins, 1984 ; Schleifer et
al., 1985), par contre le genre Lactobacillus est caractérisé par l’hétérogénéité de ces espèces
(32-53%). Chez les Bifidobacterium le pourcentage de GC% varie de 55 à 67% (Scardovi,
1986).
I-1 Le genre Lactococcus
Le terme Lactococcus est récent, puisqu’il n’a été suggéré qu’en 1985 par Schleifer et al., ;
il a été validé ensuite par l’union internationale des Sociétés de Microbiologie
(Sandine,1988). Avant, les bactéries du genre Lactococcus été appelées les streptocoques
mésophiles ou du groupe N (Tableau 2). Elles sont morphologiquement sphériques (coccis) de
0,5 à 1µm de diamètre généralement groupées en chaînes parfois en paires (diplocoques).
Se sont des germes anaérobies facultatifs ou microaérophiles, très exigeants du point de
vue nutritionnel. De nombreuses espèces sont saprophytes en particulier des produits laitiers,
certaines sont abondamment utilisées dans des industries lactiques (laiterie, fromagerie et
beurrerie). Les bactéries lactiques du genre Lactococcus sont homofermentaires et
16
Tableau 2: Caractères de différenciation des espèces de Lactococcus ssp. et Streptococcus
thermophilus d’intérêt laitier (Sandine, 1988).
Caractères
Lactococcus
Espèces
lactis
Lactis
ssp
cremoris diacetylactis
Lactococcus
Streptocoques
raffinolactis
thermophilus
Culture 10°C
+
+
+
+
-
Culture 40°C
+
+
+
-
+
Culture 45°C
-
-
-
-
+
Lait 1%BM
+
+
+
ND
-
Lait 0,3%BM
+
+
+
-
-
NaCI 2,5%
+
+
+
+
+
NaCl 4%
+
+
+
-
-
NaCI 6,5%
v
-
v
-
-
Réductase
+
+
+
+
-
Citratase
-
-
+
ND
-
Acétoine
-
-
+
ND
-
Arginine
+
-
+
-
-
Hémolyse
Gamma
Gamma
Gamma
Gamma
Alpha
N
N
N
N
-
Groupe sérologique
(+) = réaction positive, (-) = réaction négative, v = variable, ND = nom déterminé;
17
convertissent les sucres principalement en lactate (Fig. 1). Elles sont d’excellents agents
d’acidification et de caillage en fromagerie (Guiraud et Galzy, 1980).
I.-2. Le genre Lactobacillus:
Il s’agit des bacilles Gram (+) aéro-anaérobies facultatifs, ce sont des cellules souvent
longues et étroites, certaines espèces apparaissent courtes et larges, ce qui leur donne un
aspect cocobacilles (Bourgeois et Leveau, 1991); elles sont pour la plus part immobiles, toute
fois certaines espèces peuvent présenter une mobilité par ciliature piritriches (Bourgeois et
Leveau, 1991).
Leurs exigences nutritionnelles sont variables selon les espèces; elles sont soit
homofermentaires, soit hétérofermentaires, donnent de l’acide lactique DL, D, L selon les
souches. Peuvent en général pousser à des températures qui varient entre 2 et 53°C avec une
température optimale de croissance comprise entre 30 et 40°C ( Leveau et al., 1991). Leur
croissance est très lente au pH alcalin, très rapide à pH =5 avec un optimal entre 5,5 et 6,2
(Guiraud et Galzy, 1980) (Tableau 3).
Ce genre comprend 44 espèces selon la nouvelle classification du Bergey’s manual dont la
plupart sont définies par (Orla-Jensen, 1919). Ils sont repartis en trois groupes:
Groupe I: correspond au genre Thermobacterium, les espèces sont homofermentaires
obligatoires et thermophiles et sont incapables de fermenter les pentoses et les gluconates;
elles peuvent le faire en présence des héxoses ce groupe comprend 15 espèces (Bottazzi,
1988).
Groupe II: Concerne le genre Streptobacterium, ces espèces sont homofermentaires
facultatives, mésophiles, incapables de se multiplier à 45°C et peuvent le faire à 15°C
(Bourgeois et Leveau, 1991). Ce groupe comprend 11 espèces.
Groupe III: Comprend le genre Betabacterium; les espèces sont hétérofermentaires
obligatoires; certaines espèces fermentent les hexoses en donnant l’acide lactique DL et de
l’acide acétique (ou de l’éthanol) (Novel, 1993).
I- 3. Le genre Leuconostoc:
Le genre Leuconostoc appartient au groupe des bactéries lactiques, défini comme bactéries
produisant exclusivement l'acide lactique à partir de la fermentation des hydrates de carbone.
Ce sont des bactéries Gram positives, non sporulantes, immobiles aéro-anaérobies facultatifs,
catalase négative et montrant un contenu en GC moins de 50%. Comme les autres groupes des
bactéries lactiques, ils ont besoin de milieux de cultures complexes dus à leurs demandes
multiples d’aminoacides, peptides, hydrates de carbone, vitamines et ions métalliques.
18
Tableau 3: Quelques caractères distinctifs des Lactobacillus (Leveau et al., 1991).
Espèces/Croissance
à
à
15°c
45°c.
-
Lactose.
Sacc.
Glucose
Ribose
Xylose
ADH
+
-
+
-
-
-

-
+
+
-
-
-
-
-
Lb. delbrueckii ssp lactis
-
+
+
+
-
-
-

Lb. acidophilus
-
+
+
+
-
-
-
-
Lb. gasseri
-
+

+
-
-
-
-
Lb. crispatus
-
+
+
+
-
-
-
-
Lb. helveticus
-
+
+
-
-
-
-
-
Lb. plantarum
+
-
+
+
+
+

-
Lb. casei ssp casei
+
-

+
+
+
-
-
Lb.casei ssp
+
-
+
+
+
+
-
-
Lb. casei ssp tolerans
+
-
+
-
-
-
-
-
Lb. curvatus
+
-

+
+
+
-
-
Lb. brevis
+
-


+
+

+
Lb. fermentum
-
+
+
-
+
+

+
Lb. kefir
+
-
+
+
+
+
-
+
Lb. confusus
+
-
-
+
+
+
+
+
Lb. viridescens
+
-
-

-
-
-
-
Lb.delbrueckii ssp
delbrueckii
Lb.delbrueckii ssp
bulgaricus
pseudoplantarum
(-) : réaction négative. (+) : réaction positive.( ) réaction tardive. Lb.: Lactobacillus
19
Les bactéries du genre Leuconostoc fermentent le glucose par la voie des pentoses
phosphate, produisant du D-lactate, de l'éthanol et du CO2 (Fig. 1). En outre, l'acétate est
également produit quand la NADH est oxydé de nouveau en NAD+ par des accepteurs
d'électron, tels que le fructose ou l’oxygène.
Comme les autres espèce des bactéries lactiques, les espèces du genre Leuconostoc sont
d'intérêt technologique pour l'industrie des produits alimentaires et des boissons. En général,
les fermentations lactiques sont des processus biotechnologiques traditionnels, mais la plupart
restent non contrôlées. En effet, quelques espèces du genre Leuconostoc ont une importance
commerciale spéciale due à leur capacité de produire des composés aromatiques, des
polysaccharides et à la fermentation malolactique. D'autre part, quelques espèces peuvent
induire la détérioration en produisant des composés indésirables en nourriture ou le dextrane
dans les processus de fabrication de sucre.
Description du genre Leuconostoc
Le genre Leuconostoc a été défini en 1878 par Vanthieghem. Le terme leuconostoc vient
du mot Leuco qui veut dire blanc et Nostoc qui est une algue bleue mucilagineuse
(cyanobactérie). Les premières souches ont été isolées à partir d’accidents apparus dans les
sucreries. Or les leuconostocs responsables de ces accidents produisent des dextranes et en
milieu saccharose, les chaînes de coccis sont entourées d’une gaine bien distincte à l’examen
microscopique. Les travaux d’Orla-Jensen (1919) basés sur le type de l’acide lactique produit,
l’utilisation de l’arabinose et du caractère hétérofermentaire par Evans (1918), confirmés par
Garvie (1984) ont conduit à la séparation du genre Leuconostoc du genre Streptococcus.
Dans l’ancienne définition, les espèces du genre Leuconostoc étaient, selon leur
physiologie, très près des lactobacilles héterofermentaires. Ils ont été différenciés des
lactobacilles par leur morphologie et la production exclusive du D-lactate à partir de la
fermentation du glucose. Aujourd'hui, des caractères moléculaires, particulièrement ceux
basés sur des analyses d'acide nucléique, sont considérés de plus en plus dans la classification
et l'identification. Les nouveaux outils moléculaires ont mené à des changements cruciaux
pour le genre Leuconostoc (Lonvaud-Funel, 1999).
Les séquences de ARNr 16S, ARNr 23S et du gène rpoC (codant la sous unité  de l’ARN
polymérase ADN dépendant) des espèces du genre Leuconostoc et d’autres bactéries
héterofermentaires montrent qu'ils sont phylogénétiquement groupés en trois genres distincts;
le genre Leuconostoc proprement dit et les nouveaux genres Weissella et Oenococcus (Yang
et Woese, 1989).
20
Tableau 4: Les caractères distinctifs des espèces du genre Leuconostoc (Garvie, 1986)
1
2
3
4
5
6
D-xylose
+
v
-
v
-
-
Arabinose
+
-
-
v
-
v
Cellulose
v
v
-
v
-
v
Fructose
+
+
-
+
+
+
Lactose
v
v
v
v
v
-
Saccharose
+
+
-
+
+
-
Tréhalose
+
+
-
+
-
+
Hydrolyse de l’esculine
v
+
-
v
-
+
Formation de dextrane
+
+
-
-
-
-
Croissance à pH 4,8
-
-
-
v
-
+
Croissance éthanol 10 %
-
-
-
-
-
+
Acetoine (Citrate)
-
-
+
-
-
-
GC %
39
37
38
39
44
39
G-6 PDH (NAD)
+
+
+
+
+
-
Besoin TJF
-
-
-
-
-
+
Caractères
Production d’acide a partir de :
(1) Leuconoctoc
mesenteroïdes subsp mesenteroïdes ; (2) Leuconoctoc mesenteroïdes
subsp. dextranicum, (3) Leuconoctoc mesenteroïdes subsp cremoris ; (4) Leuconoctoc
paramesenteroïdes ; (5) Leuconoctoc lactis ; (6) Leuconostoc oenos ; (v) Caractère variable ;
(+) Caractère positive ; (-) Caractère négative ; G-6 -PDH = Glucose 6 Phosphate
dehydrogénase ; TJF = Tomato juice factor (Glucopanthoténate).
21
Le genre Leuconostoc comporte l’espèce Leuconostoc mesenteroides avec ses trois sousespèces
mesenteroides, dextranicum et cremoris et sept autres espèces (Leuconostoc
carnosum, Leuconostoc gelidum, Leuconostoc citreum, Leuconostoc lactis, Leuconostoc
pseudomesenteroides, Leuconostoc fallax, Leuconostoc argentinum). Ils sont bien séparés du
genre Weissella qui inclut l'ancien Leuconostoc paramesenteroides et quatre lactobacilles
héterofermentaires et d'Oenococcus (Stiles et Holzapfel, 1997).
Leuconostos oenos a été formellement différencié des autres espèces de Leuconostoc par sa
nature acidophile. Son originalité a été hautement confirmée par l'analyse des ARNr 16S et
ARNr 23S qui ont un taux d'homologie très bas avec les autres Leuconostoc ssp. Elle
représente un groupe phylogénétique si éloigné qu'un nouveau genre Oenococcus a été créé,
avec seulement une espèce oeni (Holzapfel et Schillinger, 1992).
Les corps cellulaires des leuconostocs peuvent être sphériques, mais souvent lenticulaires,
surtout lorsqu’ils sont cultivés sur milieu gélosé. Ils sont Gram positifs, non mobiles, non
sporulées et sont anaérobies facultatifs; leur optimum de température de croissance se situe
entre 20 et 30°C. Ils sont chimio-organotrophes, nécessitant pour se développer des milieux
riches comportant des facteurs de croissance complexes et des acides animés; pour ce
développer, toutes les espèces de Leuconostoc ont besoins de l’ensemble : acide nicotinique,
thiamine, biotine, acide pantothénique (ou l’un de ces dérivés) (Garvie, 1986). La croissance
ne se fait qu’en présence d’un sucre fermentescible (Tableau 4).
Les leuconostocs ne possèdent ni catalase, ni cytochromes. Ils ne produisent pas de NH3 à
partir de l’arginine. Le lait n’est en général ni acidifié ni coagulé. Ces germes sont non
protéolytique, ne produisent pas d’indole et ne réduisent pas les nitrates. Ils sont non
hémolytiques et non pathogènes pour les végétaux et les mammifères (Holzapfel et
Schillinger, 1992).
L'identification des bactéries dans les aliments fermentés ou dans la matière première rend
nécessaire d'abord l'isolement. Des milieux de culture appropriés sont inoculés. Des colonies
sont isolées et développées pour obtenir une biomasse suffisante pour tous les tests
d'identification.
La morphologie est habituellement la première détermination faite avec la coloration de
Gram. Les Leuconostoc et les Oenococcus sont des cellules presque sphériques, plutôt
lenticulaires et ressemblent à des bacilles très courts avec les extrémités arrondies (Fig. 2)
(Lonvaud-Funel, 1999).
Leur taille est approximativement 0,5–0,7 x 0,7–1,2 m. Les cellules sont arrangées en
paires ou en chaînes. Dans les milieux de cultures pendant la phase active de croissance, elles
22
sont souvent en chaînes courtes, tandis que dans leur environnement naturel et en conditions
plus stressantes les chaînes sont plus longues. La plupart de ces bactéries se développent entre
20°C et 30°C, c’est l’intervalle optimum de la température. Le pH initial du milieu de
croissance est de 6,5 et chute à 4,4–5,0 pendant la culture due à la production d'acide.
L'espèce acidophile Oenococcus oeni se développe mieux dans un milieu à pH de départ de
4,8 (Damelin et al., 1995).
Figure 2. Photos de (A) Leuconostoc mesenteroides et (B) Oenococcus œni
Au microscope électronique. (Lonvaud-Funel, 1999).
Ecologie des Leuconostocs :
Les bactéries du genre Leuconostoc sont très répandues dans la nature; on les trouvent dans
de nombreux milieux naturels et artificiels; dans ces habitats, les acides aminés, les peptides,
23
Tableau 5: Teneur en Leuconostocs de quelques fromages français fabriqués à partir
de lait cru (Devoyod et Poullain, 1988).
Fromages
Niveau (/g de fromage)
Charollais
108-109
Crottin de Chavignol
107-108
Reblochon
105-106
Pont-l’Evêque
108-109
Cœur de Bray
108
Abbaye d’Entrames
107
Tamité
107
Livarot
104
Cantal
106-107
Laguiole
107-108
Roquefort
106-107
Fourme de Montbrison
106-107
Les échantillons ont été prélevés sur des fromages prêts à être consommés.
24
les hydrates de carbone, les acides gras, les acides nucléiques et d'autres facteurs de
croissance y compris des vitamines, répondent aux exigences alimentaires de ces bactéries
(Holzapfel et Schillinger, 1992).
On les isole du lait, des produits laitiers, des fruits, des légumes en particulier de la
betterave (d’où leur ancien nom Betacoccus), des végétaux en fermentation : par exemple de
la choucroute (Rodolphe et al., 2002), des produits de panification (Stiles et Holzapfel, 1997)
et des solutions visqueuses de sucre dans les sucreries (pour une revue, voir Devoyod et
Poullain, 1988). L’espèce Oenococcus oeni est absente du lait et isolée du vin (Dicks et al.,
1995).
Les leuconostocs préfèrent les milieux neutres aux milieux légèrement acides, excepté
l'espèce Oenococcus oeni (Lonvaud-Funel, 1999). Une meilleure croissance a été constatée à
des températures ambiantes de 20 à 30°C, avec un minimum autour de 5°C à l’exception des
leuconostocs isolées des viandes Leuconostoc gelidum et Leuconostoc carnosum, qui peuvent
se développer à 1°C (Shaw et Harding, 1989). La plupart des souches sont aérotolérantes,
mais la croissance est plus prolifique sous atmosphère réduite (Holzapfel et Schillinger,
1992).
La sous espèce Leuconostoc mesenteroides subsp. mesenteroides est la plus fréquemment
isolée des plantes et des fruits. Généralement, elle lance le procédé de fermentation et
augmente l'acidité totale. À mesure que le pH augmente, Leuconostoc mesenteroides subsp.
mesenteroides qui tolère mieux le pH acide disparaît laissant la place à d'autres espèces de
bactéries lactiques (Daeschel et al., 1987).
Les deux espèces Leuconostoc gelidum et Leuconostoc carnosum se content parmi la
population microbienne des viandes pendant le stockage en emballages sous vide ou
atmosphère de CO2. Elles sont associés à d’autres genres de bactéries lactiques et altèrent la
viande en produisant un changement de couleur, des mauvais goûts ainsi que des mauvaises
odeurs (Shaw et Harding, 1989). Par contre, Leuconostoc lactis a été seulement isolée à partir
des produits laitiers. Elle possède une résistance thermique plus élevée comparée à d'autres
espèces du même genre (De Roissart et Luquet, 1991).
Fréquemment, on rencontre les Leuconostocs dans le lait (De Roissart et Luquet, 1991 ;
Holzapfel et Schillinger, 1992), la crème et le beurre (Levata-Jovanovic et Sandine, 1996), les
différents types de fromages essentiellement les espèces Leuconostoc mesenteroides et
Leuconostoc dextranicum (Tableau 5) et entrent couramment dans la composition de levains
utilisés pour la fabrication de nombreux produits laitiers tels que le fromage de Roquefort
(Devoyod et al., 1974).
25
A
Citrate
Acétate
Citrate
Acétate
1
Oxaloacétate
co-substrat
1
Oxaloacétate
Na+
CO2
B
2[H]
6
2
Pyruvate
ATP
Malate
Formate
7
3
Acétyl-CoA
Fumarate
2[H]
8
4
Acétyphosphate
Succinate
CO2
ATP
5
Acétate
Citrate
Acétate
C
Acétate
2[H]
10
7
H+
8
Succinate
CO2
CO2
2
Pyruvate
2-Oxoglutarate
Malate
Fumarate
Oxaloacétate
Isocitrate
Oxaloacétate
6
1
9
1
11
2[H]
D
Citrate
Citrate
CO2
CO2
Succiyl-CoA
H2
12
(H)
ATP
Succinate
Ethanol
Acétyl-CoA
Acétate
Figure 3 : voies de fermentation du citrate chez (A) Klebseilla pneumoniae (O’Brien et Stern, 1969), (B) E.
coli (Lütgens et Gottschalk, 1980), (C) Providencia regtteri (Kröger, 1974) et (D) Clostridium sphenoides
(Antranikiane et Gottschalk, 1989).
1, citrate lyase ; 2, oxaloacétate décarboxylase ; 3, pyruvate formate lyase ; 4, phosphotransacétylase ; 5, acétate
kinase ; 6, malate déshydrogénase ; 7, fumarase ; 8, fumarate réductase ; 9, aconitase ; 10, isocitratedéshydrogénase ;
11, 2-oxaloglutarate déshydrogénase ; 12, succinate thiokinase.
26
II. LE METABOLISME DE L’ACIDE CITRIQUE
Le citrate est un intermédiaire centrale du cycle des acides tricarboxyliques. Il joue un rôle
important dans le métabolisme énergétique des cellules vivantes. Le citrate est également un
précurseur de la synthèse des acides aminés.
Chez les bactéries, en conditions d’aérobiose, le métabolisme de l’acide citrique s’effectue
via le cycle de Krebs. En revanche, chez les bactéries qui possèdent un cycle tricarboxylique
incomplet (telles que les bactéries phototrophes, les Clostridia et les bactéries lactiques), le
citrate peut être métabolisé en conditions d’anaérobie. Les bactéries phototrophes et les
Clostridia ont fait l’objet de travaux sur la régulation du métabolisme du citrate en raison de
la présence d’une citrate synthase chez de nombreuses espèces. Cette voie a été bien élucidée
chez Clostridium sphenoides (Antranikiane et Gottschalk, 1989) (Fig. 3D). La fermentation
du citrate procède par clivage du citrate en acétate et oxaloacétate. Ce dernier est par la suite
décarboxylé en pyruvate. En plus de l’acétate, de l’éthanol est produit en faibles quantités. La
conversion de l’acétyl-CoA en acétate via l’acétate kinase génère de l’ATP.
Les entérobactéries offrent un modèle assez hétérogène vis avis du métabolisme du citrate.
En conditions d’aérobiose, l’utilisation du citrate via le cycle de Krebs dépend de la présence
d’un système de transport adéquat. En conditions d’anaérobiose, certaines espèces telles que
Klebseilla pneumoniae et Salmonella typhimurium peuvent emprunter la voie de fermentation
du citrate aboutissant à la formation de l’acétate, du formate et du CO2. Cependant, les
espèces dépourvues d’oxaloacétate décarboxylase, empruntent une voie différente. Ainsi, trois
voies de fermentation du citrate ont été décrites chez les entérobactéries.
La première décrite chez E. coli, se caractérise par la nécessité d’un co-substrat
(glucose, lactose, pyruvate, L-lactate) (Lütgens et Gottschalk, 1980). En condition
d’anaérobiose, E. coli peut utiliser le citrate, mais emploie une voie différente en raison de
l’absence de l’oxaloacétate décarboxylase. L’oxaloacétate formé par le clivage du citrate
grâce à la citrate lyase est converti en succinate via le malate et le fumarate (Fig. 3B). En
raison du cycle de Krebs dans ces conditions, un second substrat doit être disponible, dans le
but de pallier à la déficience en protons lors de la synthèse du succinate.
La seconde voie, décrite chez Providencia rettgeri, est similaire à celle d’E. coli.
Cependant, un co-substrat n’est pas nécessaire puisque les équivalents réducteurs sont fournis
par l’oxydation du citrate en succinate via certaines réactions du cycle de Krebs (Fig. 3C)
(Kröger, 1974).
27
Extérieur
2 H+
1 cit2-
Intérieur
CitS
+
1 Na
Na+
Fermentation du citrate
Oxaloacétate décarboxylase
CO2
Acétate
Formiate
Figure 4 : Modèle pour le transport du citrate à travers la membrane, via CitS chez
Klebseilla pneumoniae (Lolkema et al., 1994 ; Van Der Rest et al., 1992).
Extérieur
cit23 H+
Intérieur
CitH
TCA
Pompe à protons
Na+
Figure 5 : Modèle pour le transport du citrate à travers la membrane, via CitH chez
Klebseilla pneumoniae (Van Der Rest et al., 1992).
28
La troisième voie, décrite chez Klebseilla pneumoniae et Salmonella typhimurium
(O’Brien et Stern, 1969), fait intervenir une oxaloacétate décarboxylase Na+-dépendante (Fig.
3A). Cette voie a fait l’objet d’études biochimiques et de caractérisations moléculaires chez
Klebseilla pneumoniae. Les protéines impliquées dans la fermentation du citrate et les
mécanismes mis en jeu ont été bien étudiés (Bott, 1997 ; Bott et Dimroth, 1994 ; Bott et al.,
1995 ; Di Berardino et Dimroth, 1995 ; Di Berardino et Dimroth, 1996 ; Dimroth, 1994 ;
Dimroth et Thomer, 1993 ; Meyer et al., 1997).
II.1. Protéines impliquées dans le métabolisme anaérobie du citrate.
L’utilisation du citrate dans des conditions d’anaérobioses, implique la formation et
l’intervention d’un équipement enzymatique spécifique. Dans les conditions de pH,
correspondant à la croissance de ces micro-organismes (pH 5-7), le citrate (dont les pKa sont
de 3,2 , 4,8 et 6.4) se trouve sous forme chargée et ne peut pas diffuser passivement à travers
la membranes cytoplasmique. L’entré du citrate dans la cellule nécessite un système de
transport (protéine membranaire) et son métabolisme anaérobie implique l’intervention de
deux enzymes cataboliques : citrate lyase et oxaloacétate décarboxylase.
II.1.1. Les systèmes bactériens de transport du citrate.
L’utilisation de l’acide citrique chez les bactéries est souvent associée à des systèmes de
transport dépendant de cations (Tableau 6).
Les transporteurs dépendants des ions Na+ ont été décris chez Klebseilla pneumoniae
(CitS) (Dimroth et Thomer, 1986 ; Dimroth et Thomer, 1990 ; Johnson et al., 1975 ; O’Brien
et Stern, 1969), et chez Salmonella typhimurium (CitC) (Ishiguro et al., 1992).
Les transporteurs impliquant des protons ont été décris chez Bacillus subtilis (CitM)
(Boorsma et al., 1996), chez Klebseilla pneumoniae (CitH) (van Der Rest et al., 1991 ; van
Der Rest et al., 1990), chez Salmonella typhimurium (CitA) (Shimamoto et al., 1991) et chez
des souches d’E. coli utilisant le citrate. Chez Bacillus subtilis, le transport du citrate est
couplé à des ions métalliques divalents avec une préférence pour le Mg2+ (Bergsma et
Konings, 1983 ; Boorsma et al., 1996). Les gradients électrochimiques de cations, maintenus
de part et d’autre de la membrane cytoplasmique, constituent une force protomotrice utilisée
pour l’entrée du citrate par les transporteurs.
Chez Klebseilla pneumoniae, en conditions d’anaérobiose, l’utilisation du citrate est Na+
dépendante (Dimroth et Thomer, 1986 ; Johnson et al., 1975). CitS serait responsable du
transport du citrate en symport avec un ion sodium et deux protons (2Na+/citrate) (Lolkema et
al., 1994 ; Schwarz et Oesterhelt, 1985 ; van Der Rest et al., 1991) (Fig. 4).
29
En revanche, le transport par CitH s’effectue via un symport avec trois protons
(3H+/citrate) (van Der Rest et al., 1991) (Fig. 5). Ce transporteur est probablement
responsable du transport de citrate en aérobiose (Bott, 1997). En revanche chez Salmonella
typhimurium, le transport du citrate est dépendant des ions Na+ en conditions d’anaérobiose et
d’aérobiose (Pos et al., 1998).
Récemment, Pos et al. (1998), ont décrit chez E. coli un nouveau transporteur (CitT)
appartenant à une nouvelle famille de transporteurs secondaires d’acides dicarboxyliques et
tricarboxyliques (Weber et al., 1995). Les études de transport dans des souches d’E. coli
transformées ont montré que citT catalyse un échange de citrate contre le fumarate, tartrate ou
succinate. Comme ce dernier est le produit de fermentation du citrate chez E. coli, il a été
proposé que CitT catalyserait un échange citrate/succinate (Pos et al., 1998).
30
Tableau 6 : Caractérisation fonctionnelle des systèmes de transport chez les bactéries.
Protéines
Caractéristiques
CitH
Klebseilla pneumoniae
Transport secondaire avec force proton motrice
Citrate transporté sous forme Hcit2Symport avec 3 protons
Posséde un motif commun avec d’autres transporteurs H+/sucre
CitS
Klebseilla pneumoniae
Inductible et présent en aérobiose
Na+ dépendant
Transport secondaire avec force proton motrice
Citrate transporté sous forme Hcit2Symport avec 1 Na+ et 2 H+
Symport avec 2 Na+ et 1 H+
CitT
Escherichia coli
CitC
Salmonella typhimurium
CitM
Bacillus subtilis
Références
Van Der Rest et al ., 1990
Van Der Rest et al ., 1991
Schwarz et Oesterhelt, 1985
Van Der Rest et al ., 199
Lolkema et al., 1994
Antiport citrate/succinate (hypothèse)
Labarre et al., 1996
Na+ dépendant
Ishiguro et al., 1992
Le substrat est le complexe citrate-Mg2+
Symport substrat/proton
Boorsma et al., 1996
CitP
Lactococcus lactis
Echange d’un Lac- contre Hcit2-
Magni et al., 1999
CitP
Leuconostoc mesenteroides
Echange d’un Lac- contre Hcit2-
Bandell et al., 1998
31
II.1.2. Les citrate lyases bactériennes (EC 4.1.3.6). Pour revue, voir, Bacterial citrate lyase
(Subramanian et al., 1983).
Rôle métabolique.
Deux types de systèmes enzymatiques impliqués dans le clivage du citrate ont été décrits.
Chez les eucaryotes, le clivage du citrate est catalysé par une ATP-citrate lyase
cytoplasmique (EC 4.1.3.8) selon la réaction suivante :
Citrate+ATP+CoA
Acétyl –CoA+ADP+Pi+Oxaloacétate
L’acetyl-CoA ne peut être transporté de la mitochondrie vers le cytoplasme. Le citrate, issu
de la condensation d’un acétyl-CoA et d’un oxaloacétate catalysé par la citrate synthase
mitochondriale est transporté à travers la membrane mitochondriale vers le cytoplasme. Ainsi,
l’ATP-citrate lyase permet de régénérer dans le cytoplasme de l’Acétyl-CoA nécessaire aux
voies de biosynthèse et particulièrement à la biosynthèse des acides gras et du chlolesterol. La
première ATP-citrate lyase a été purifée des cellules de foie de rat. La protéine est constituée
de 4 sous-unités identiques (400 kDa) (Singh et al., 1976).
Chez les procaryotes, en analysant les produits de fermentation du citrate chez Klebseilla
pneumoniae et Aerobacter indologenes, Deffner et Franke (1939) et Brewer et Werkman
(1939) ont démontré que l’oxaloacétate et l’acétate sont des produits issus du clivage du
citrate. L’enzyme responsable de cette hydrolyse a été caractérisée pour la première fois chez
Klebseilla pneumoniae (Dagley et Dawes, 1953). Plusieurs travaux ont permis, par la suite, de
démontrer que la citrate lyase est l’enzyme clé du métabolisme anaérobie du citrate chez de
nombreuses espèces bactériennes et dont la structure et le mode de fonctionnement sont
totalement differents.
Relation structure fonction.
Chez les micro-organismes où la citrate lyase a été purifiée, celle-ci est présente sous
forme d’un complexe multi-protéique de 500-600 kDa, constitué de trois sous unités  et 
associées selon une stoechiométrie 
Les études biochimiques sur la relation structure fonction de la citrate lyase de Klebsiella
pneumoniae ont permis d’identier deux composantes enzymatiques, représentés par les deux
sous unités et , et un acyl carrier protéin (ACP) représenté par la sous unité .
32
L’activité acyl-transférase EC 2.8.3.10 : Cette activité est assurée par la sous unité . La
citrate acyl-transférase catalyse la réaction d’échange du groupement acétyl par un
groupement citryl selon l’équation suivante :
Acétyl-S-ACP + Citrate
Acétate + Citryl-S-ACP
Cette réaction ne nécessite pas la présence de métaux. Le poids moléculaire de la sous
unité des citrates lyases bactériennes est compris entre 54 et 56 kDa. Un résidu argénine
impliqué dans la formation du site actif de l’acyl transférase a été décrit par Subramanian et
al., (1983).
L’activité acyl lyase EC 4.1.3.34 : appelée également la citryl-CoA lyase, catalyse en
présence d’ions Mg2+, la réaction de clivage du citrate en libérant de l’oxaloacétate.
Citryl-S-ACP
Acétyl-S-ACP + Oxaloacétate
L’Acyl carrier protein (ACP) de la citrate lyase :
En se basant sur les observations suivantes :
La désacétylation de la citrate lyase native conduit à son inactivation ; l’enzyme
contient du phosphopantétheine et est composée de 3 sous unités.
Par analogie aux acides gras synthétases, il a été déduit que la sous unité  est l’acyl carrier
protéin de la citrate lyase et que le phosphopantétheine représente le groupement prosthétique
de l’acyl carrier protéine (Dimroth et al., 1973).
Par la suite, de nombreuses études biochimiques ont permis de déterminer la composition
et la structure du groupement prosthétique. Il s’agit d’un groupement 5-phosphoribosyldephospho-CoA, lié par son ribose-5-phosphate à la serine 14 de l’ACP via, un pont
phosphodiester (Beyreuther et al., 1978 ; Dimroth, 1976 ; Oppenheimer et al., 1979 ;
Robinson et al., 1976 ; Singh et al., 1977).
Fonctionnement de la citrate lyase
Le clivage du citrate par la citrate lyase s’effectue en deux étapes principales. La première
consiste en un échange du groupement acétyl de l’ACP par un groupement citryl catalysé par
33
la sous unité . Après activation du substrat (citrate), la seconde étape catalysée par la sous
unité , complète le cycle par hydrolyse du groupement citryl en libérant de l’oxaloacétate et
régénérant ainsi de l’acétyl-ACP (Fig.6) (Bott et al., 1995).
La citrate lyase n’est activée que si le groupement prosthétique de l’ACP est acétylé.
L’activation in vivo de la citrate lyase est réalisée par la citrate lyase ligase, qui en présence
d’ATP et d’acétate, catalyse l’acétylation du groupement prosthétique. L’acétylation ainsi que
la désacétylation du groupement prosthétique de la citrate lyase peuvent être obtenues
chimiquement in vitro.
La citrate lyase native est sujette à une inactivation dont le mode majeur procède par une
réaction de désacétylation de son groupement prosthétique. La stabilité des solutions purifiées
peut être améliorée par congélation à -90°C (Singh et Srere, 1975), en présence de sulfate
d’ammonium ou en présence d’ions tels que Mg2+ et Ca2+ (Blair et al., 1955 ; Esenthal et al.,
1966). Les citrates lyases de E. coli et de K. pneumoniae sont inhibés par l’oxaloacétate mais
pas par l’acétate (Dagley et Dawes, 1955). Le malate peut également arrêter son activité de
façon irréversible. Les mécanismes mis en jeu sont complexes et peu étudiés.
H-S-R-ACP
Acétate+ATP
1
AMP+PPi
Acétyl-S-R-ACP
(acetyl-S-CoA)
Oxaloacétate
3
Citrate
2
Acétate
Citryl-S-R-ACP
(citryl-S-CoA)
Figure 6: Fonctionnement de la citrate liasse chez Klebsiella pneumoniae
1-acétate :SH-citrate lyase ligase. ACP, acyl carrier protein, (sous- unité  2-citryl-S-R-ACP
transferase (sous-unité ). 3-acétyl-S-R-ACP lyase (sous-unité ). (Bott et Dimroth, 1994).
34
II.1.3. Les oxaloacétates décarboxylases
L’oxaloacétate décarboxylase (EC 4.1.1.3) catalyse la décarboxylation de l’oxaloacétate en
pyruvate selon la réaction :
Oxaloacétate
Pyruvate+CO2
L’enzyme la plus étudiée est celle de Klebsiella pneumoniae (Dimroth, 1981 ; Dimroth,
1982a , Dimroth, 1982b ; Dimroth, 1987 ; Dimroth et Thomer,1983 , Dimroth et
Thomer,1993). La protéine purifiée est sous forme d’un complexe enzymatique associé à la
membrane cytoplasmique; elle est constituée de trois sous unités  et associées en 
avec les poids moléculaires respectifs de 63,6 , 44,9 et 8,9 kDa.
La réaction globale implique une carboxylation du groupement prosthétique biotine par
carboxyltransfert de l’oxaloacétate catalysé par la sous unité cytoplasmique . Les deux sous
unités membranaires  et  complètent le cycle par décarboxylation de la carboxylbiotine,
couplée à la translocation des ions Na+ à travers la membrane (Dimroth et Thomer, 1986 ;
Dimroth et Thomer, 1993) (Fig. 7). Les ions Na+ qui sont pompés vers l’extérieur de la cellule
lors de cette décarboxylation sont récupérés lors du symport de citrate.
2Na+
R-COO-
RH
CO2
Biotine-carrier
H+
CO2- Biotine-carrier
2Na+
Carboxyltransfert (
Extérieur
Intérieur
Décarboxylation (
Figure 7 : Mécanisme du fonctionnement de l’Oxaloacétate décarboxylase chez Klebsiella
pneumoniae (Dimroth et Thomer, 1993).
35
II.2. Le métabolisme du citrate chez les bactéries lactiques.
Le caractère de l’utilisation du citrate est répandu parmi toutes les espèces du genre
Leuconostoc, contrairement aux lactocoques où seul Lactococcus lactis subsp. lactis biovar.
diacetylactis en est capable. La voie de dégradation de l’acide lactique chez les bactéries
lactiques est représentée dans la figure 8.
Citrate
Extérieur
1
Intérieur
Acétate
Sucre
Oxaloacétate
Citrate
2
3
CO2
H
+
Acétate
Pyruvate
Lactate
9
10
Formiate
4
CO2
Acétyl CoA
Acétaldéhyde TPP
Pyruvate
Ethanol
TPP
5
CO2
Acétolactate
Diacétyle
8
6
H+
CO2
Acétoïne
7
H+
2,3 Butanediol
Figure 8. Principales étapes du métabolisme du citrate par les bactéries lactiques (Diviès et al., 1994).
1, citrate perméase ; 2, citrate lyase ; 3 oxaloacétate décarboxylase ; 4, pyruvate décarboxylase ; 5, -acétolactate synthase ; 6, acétolactate décarboxylase ; 7, acétoïne réductase ; 8, diacétyle réductase ; 9, pyruvate formiate lyase ; 10, lactate déshydrogénase.
36
Le citrate est transporté à l’intérieur de la cellule grâce à une citrate perméase, puis scindé
en acétate et oxaloacétate grâce à une citrate lyase. L’oxaloacétate est décarboxylé par la suite
en pyruvate via une oxaloacétate décarboxylase.
Le flux du pyruvate provenant du métabolisme est principalement transformé en lactate via
la lactate déshydrogénase (LDH) afin de réoxyder le NADH2 produit lors du catabolisme du
glucose.
A pH acide, le Km de la lactate déshydrogénase pour le pyruvte est faible chez
Leuconostoc. La synthèse des composés en C4 (acétoine, diacétyle et 2,3 butanediol) est ainsi
favorisée. La formation des composés aromatiques est observée essentiellement en conditions
de l’imitation de glucose (Cogan, 1987 ; Schmitt et Diviès, 1991) chez Leuconostoc. Elle est
favorisée dans des conditions de limitation de sucre et en anaérobiose chez Lactococcus
(Starrenburg et Hugenholtz, 1991).
La synthèse du diacétyle fait intervenir plusieurs étapes.
L’-acétolactate synthase catabolique (pH optimal 6) catalyse la condensation de deux
molécules de pyruvate :
Pyruvate+TPP-ALS
Hydroxyéthyl-TPP-ALS+CO2
Hydroxyéthyl-TPP-ALS+CO2+ Pyruvate
TPP-ALS+Acétolactate
L’-acétolactate décarboxylase, enzyme allostérique chez Lactococcus et michaelienne
chez Leuconostoc (Garmyn et al., 1996 ; Phalip et al., 1994) catalyse la décarboxylation de
l’acétolactate en acétoine :
Acétolactate
CO2+Acetoine
L’-acétolactate peut également être décarboxylé en diacétyle par voie chimique.
L’acétoine formée par l’action successive de l’-acétolactate synthase et de l’acétolactate décarboxylase est réduite de manière réversible en 2,3 butanediol par l’action de
la 2,3 butanediol déshydrogénase. Cette enzyme catalyse également la réaction irréversible du
diacétyle en acétoine (Crow, 1990 ; Gibson et al., 1991).
Le pyruvate peut être hydrolysé par la pyruvate formiate lyase (cette enzyme n’est pas
décrite chez Leuconostoc). Cette enzyme est responsable de la formation du formiate,
37
Ethanol
A
2NADH
2NADH
Acétyl-P
Glucose
ATP
NADH
Pyruvate
NADH
Lactate
B
ATP
2NADH
3 Acétate
Acétyl-P
Glucose
2 Citrate
ATP
NADH
3 Pyruvate
3 NADH
3 Lactate
Figure 9 : Métabolisme du glucose (A) et du co-métabolisme du glucose/citrate (B) chez Leuconostoc
(Marty-Teysset et al., 1996).
Le co-métabolisme citrate/sucre conduit à une augmentation de la production d’acétate, de D-lactate, d’ATP et une
diminution de la production d’éthanol. Les stoechiométries dans le schéma B indique le nombre de molécules
nécessaires à l’équilibre redox. Deux des trois molécules d’acétate proviennent du citrate, l’autre provient du glucose.
Une molécule de CO2 est formée par mole de citrate.
38
d’acétate et d’éthanol à partir du pyruvate et de coenzyme A. Elle est active chez les
lactocoques en anaérobiose et dans des conditions de limitation en glucose (Brown et Collins,
1977). Les lactocoques possèdent également une pyruvate déshydrogénase (cette enzyme
n’est pas décrite chez Leuconostoc) qui catalyse la réaction suivante :
Pyruvate+NAD+Coenzyme A
acétyl-coenzyme A+NADH2+CO2
Cette enzyme est exprimée préférentiellement en aérobiose.
II.2.1. Le cométabolisme sucre/citrate chez Leuconostoc.
Leuconostoc ne peut utiliser le citrate comme seule source d’énergie pour sa croissance.
Plusieurs travaux ont montré que l’apport du citrate à un milieu contenant un sucre
fermentescible stimule fortement la croissance de Leuconostoc et favorise la voie de synthèse
du diacétyle (Cogan, 1987 ; Lin et al., 1991 ; Schmitt et Diviès, 1991 ; Schmitt et Diviès,
1992 ; Starrenburg et Hugenholtz, 1991). La production des composés en C4 n’a lieu que si le
pyruvate disponible est supérieur à celui nécessaire à la réoxydation de la NADH2 produit à
partir des sucres.
La stimulation de la croissance a été attribuée d’une part à un changement métabolique de
la voie de glucose, et d’autres part à la génération d’une énergie métabolique secondaire via le
métabolisme du citrate (Marty-Tyesset et al., 1996).
En présence de citrate, la production d’éthanol diminue alors que celle de l’acétate, du Dlactate et d’ATP augmente. Cette modification du flux du carbone est attribuée à une
modification de l’activité de certaines enzymes telles que l’alcool déshydrogénase (ADH),
réprimée par le citrate, et l’acétate kinase (AK) dont l’activité augmente. Au lieu d’être utilisé
pour la production d’éthanol, le NADH est utilisé pour la conversion du pyruvate provenant
du citrate en D-lactate. L’acétyl-phosphate est ainsi réduit en éthanol en absence de citrate
alors qu’il est converti en acétate avec production d’ATP via l’acétate kinase, en présence de
citrate (Cogan, 1987 ; Schmitt et Diviès, 1992 ; Schmitt et al., 1990) (Fig. 9).
Lors du cométabolisme citrate/glucose, le lactate résultant du métabolisme du glucose et
du citrate quitte la cellule par un mécanisme de symport avec protons et par mécanisme
d’antiport avec citrate (Marty-Tyesset et al., 1996). Ce cométabolisme maintient un gradient
de D-lactate, dirigé de l’intérieur vers l’extérieur, qui avec un gradient de citrate, dirigé dans
l’autre direction, constituent les conditions idéales pour un échange citrate/D-lactate. Cet
échange citrate/D-lactate est électrogénique. La forme dianionique du citrate pénètre dans la
cellule en échange avec la forme monoanionique du lactate Hcit2-/lac-. La charge nette du
39
processus du transport est donc négative. L’entrée du citrate génère un potentiel de
membrane. La dégradation du citrate conduit à la consommation d’un proton et donc à la
création d’un gradient de pH, lors de la décarboxylation de l’oxaloacétate en pyruvate (MartyTyesset et al., 1996).
Les travaux de Marty-Teysset et al. (1996) ont ainsi montré que la génération d’énergie
métabolique secondaire par le métabolisme du citrate pourrait contribuer significativement à
la stimulation de croissance et servir à d’autres processus cellulaires endergoniques.
Les résultats sur le cométabolisme du citrate/xylose ont montré que le rendement de la
croissance est plus élevé que dans le cas de citrate/glucose. En effet, en présence de xylose,
une forte accumulation d’acétate est observée alors que l’éthanol est faiblement produit. Une
quantité importante de diacétyle-acetoine est également produite. Ceci a été attribué au fait
qu’en présence de xylose, seulement une mole de NADH doit être oxydée, ce qui est fait
grâce à la réduction du pyruvate en lactate. Les voies conduisant à l’acétaldehyde et l’éthanol
ne sont pas utiles. L’acétate est produit via la voie de l’acétate kinase. Ceci permet la
récupération d’une mole d’ATP, ce qui peut expliquer le meilleur rendement de croissance.
Quand du citrate est ajouté, le pool de pyruvate augmente (moins de NADH à réoxyder par la
production de lactate). Ce pool est ainsi disponible pour la voie de synthèse du diacétyle
(Schmitt et al., 1997).
II.2.2. Mécanismes du transport du citrate chez les bactéries lactiques.
Le mécanisme du transport du citrate a été particulièrement étudié chez Leuconostoc
mesenteroides. Chez Leuconostoc mesenteroides subsp. mesenteroides, le citrate est
transporté par un transporteur secondaire. Des études cinétiques mécanistiques du transport du
citrate réalisées sur des vésicules membranaires, ont montré que CitP catalyse un symport
Hcit2-/H+ (Marty-Tyesset et al., 1996). Cependant, des études réalisées avec des cellules
viables révèlent un échange efficace du citrate et du lactate suggérant que dans les conditions
physiologiques, CitP peut fonctionner comme un échangeur citrate/lactate plutôt qu’un
symport (Marty-Tyesset et al., 1996). Cet échange citrate divalent/lactate monovalent catalysé
par CitP génère un potentiel de membrane (), négatif à l’intérieur. La consommation de
protons par la décarboxylation de l’oxaloacétate génère un gradient de pH (pH), alcalin à
l’intérieur. Ceci est à l’origine de la création d’une force proton motrice (Fig. 10).
40
Hcit2-
Lac-
Glc
Acide
+++++
Alcalin
----Lac
Hcit2-
Extérieur
Intérieur
-
[H+]
[H+]
Oxacé
Acé-
Pyr-
2-
Acé-
Lac-
Pyr-
[H+]
Figure 10 : Schéma représentatif du mécanisme de la génération de la force proton motrice par la
fermentation citrolactique chez Leuconostoc mesenteroides (Bandell et al., 1998).
Hcit, citrate ; Lac, lactate ; Acé, acétate ; Oxacé, oxaloacétate ; Pyr, pyruvate ; Glc, glucose
La génération d’énergie métabolique sous forme d’un (pH) et d’un () par le
métabolisme du citrate est largement dépendante du cométabolisme citrate/glucose, la
création de cette énergie métabolique peut expliquer l’augmentation significative du taux de
croissance de Leuconostoc observée lors du co-métabolisme du glucose/citrate (MartyTyesset et al., 1996).
Chez Lactococcus lactis subsp. lactis biovar. diacetylactis, le transport du citrate fait
intervenir une citrate perméase de type protonique active à pH 6 (Konings et al., 1989). Ce
système nécessite une source d’énergie métabolique dans des conditions qui ne permettent pas
l’accumulation intracellulaire de la substance transportée (Konings et al., 1989).
Des études de transport dans des vésicules membranaires préparées à partir de cellules d’E.
coli, expriment CitP de Lactococcus lactis, ont suggéré un mécanisme de transport en symport
avec les protons comparables à celui de CitH de Klebsiella pneumoniae (David et al., 1990)
d’autres études réalisées avec des cellules entières de Lactococcus lactis suggèrent un
mécanisme d’échange entre le citrate (sous sa forme dianionique Hcit2-) et un produits du
métabolisme du citrate : l’acétate ou le pyruvate sous sa forme monoanionique (Hugenholtz,
1993).
Des études récentes sur le transport du citrate chez Lactococcus lactis subsp. lactis biovar.
diacetylactis ont montré que CitP catalyse un échange citrate/lactate comme dans le cas de
Leuconostoc mesenteroides (Magni et al., 1999). Mais dans le cas de Lactococcus lactis, le
lactate provient du métabolisme du glucose (Fig. 11). En absence de ce dernier, CitP catalyse
un symport citrate/proton qui génère une force proton motrice moins importante.
41
En résumé, on peut dire que les interactions entre métabolisme du citrate et celui du
glucose fournissent le lactate nécessaire au fonctionnement de CitP comme antiport
citrate/lactate.
Hcit2-
Lac-
Glc
Acide
+++++
Alcalin
----Lac
Hcit2-
Extérieur
Intérieur
-
ATP
PyrLacPyr-
Oxacé2Acé-
[H+]
Figure 11: Schéma représentatif du mécanisme de la fermentation du citrate et de l’extrusion du lactate
chez Lactococcus lactis (Magni et al., 1999).
Hcit, citrate ; Lac, lactate ; Acé, acétate ; Oxacé, oxaloacétate ; Pyr, pyruvate ; Glc, glucose
II.2.3. Citrate lyase et Oxaloacétate décarboxylase des bactéries lactiques.
La citrate lyase est inductible par le citrate chez Leuconostoc et constitutive chez
Lactococcus (Harvey et Collins, 1961). Purifiée chez Lactococcus lactis subsp. lactis biovar.
diacetylactis (Singh et Srere, 1975) et Leuconostoc mesenteroides subsp. cremoris (Bekal et
al., 1998), la citrate lyase est présente sous forme d’un complexe d’environ 585 kDa,
composé de trois sous-unités de 53, 34 et 10 kDa chez Lactococcus lactis subsp. lactis biovar.
diacetylactis et forme un complexe d’environ 618 kDa, composé de trois sous-unités de 55,
34 et 14 kDa chez Leuconostoc mesenteroides subsp. cremoris.
L’oxaloacétate décarboxylase est présente chez toutes les bactéries lactiques fermentant le
citrate. Seule l’oxaloacétate décarboxylase de Lactococcus lactis subsp. lactis biovar.
diacetylactis a fait l’objet d’une caractérisation après purification (Hugenholtz et al., 1993). Il
s’agit d’un complexe de trois sous-unités organisées en 333 avec des poids moléculaires de
52, 34 et 12 kDa respectivement. Les données physiologiques sur l’oxaloacétate
décarboxylase des bactéries lactiques, montrent que son activité est constitutive chez
42
Lactococcus et inductible par le citrate chez Leuconostoc (Harvey et Collins, 1961, Lin et al.,
1991 ; Mellerick et Cogan, 1981 ; Schmitt et Diviès, 1992).
En résumé, chez le genre Leuconostoc les trois enzymes du métabolisme du citrate (citrate
perméase, citrate lyase, oxaloacétate décarboxylase) sont inductibles par leur substrat (Harvey
et Collins, 1961, O’Farell, 1975 ; Mellerick et Cogan, 1981 ; Schmitt et Diviès, 1992 ; MartyTyesset et al., 1996).
III. GENETIQUE DE LA FERMENTATION DU CITRATE CHEZ LES BACTERIES
Jusqu’en 1995, Klebseilla pneumoniae était la seule bactérie où la fermentation du citrate a
fait l’objet d’une caractérisation génétique ciblée (Bott et al., 1995). Par la suite, le
séquençage des génomes bactériens, Haemophilus influenzae (Fleischmann et al., 1995) et
Escherichia coli (Blattner et al., 1997), a révélé l’organisation des gènes impliqués dans le
métabolisme anaérobie du citrate.
III. 1. Chez Les Enterobacteries
La génétique de la fermentation du citrate a été bien élucidée chez quelques espèces de la
famille des entérobactéries. Il est cependant nécessaire de signaler, qu’il pourrait y avoir des
confusions, à partir du moment où des gènes codant pour des protéines de fonctions
différentes portent le même nom. C’est le cas de citC qui code pour la citrate lyase ligase chez
Klebseilla pneumoniae, Haemophilus influenzae, Leuconostoc mesenteroides, Escherichia
coli alors que citC de Salmonella typhimurium code pour un transporteur de citrate. C’est le
cas également de citA qui code pour une sensor kinase chez Klebseilla pneumoniae. Le gène
du même nom chez d’autres bactéries code pour un transporteur de citrate.
III.1.1. Chez Klebseilla pneumoniae
Les mécanismes impliqués dans la régulation des gènes du métabolisme du citrate ont été
bien étudiés chez cette bactérie.
Les premiers gènes structuraux de la citrate lyase ont été identifiés chez Klebseilla
pneumoniae (Bott et al., 1995) en amont du gène citS codant pour le transport du citrate. Le
groupe de gènes est organisé en 5 phases ouvertes de lecture dans le sens de transcription
citCDEFG (Fig. 12). Le gène citC code pour la citrate lyase ligase (PM 38.5 kDa), citDEF
codent pour les trois sous-unités de la citrate lyase et  respectivement alors que citG
code pour une protéine CitG responsable de la biosynthèse du groupement prosthétique de la
sous unité  (Acyl Carrier Protein) de la citrate lyase (Schneider et al., 2000).
Les gènes de l’oxaloacétate décarboxylase de Klebseilla pneumoniae ont été clonés et
séquencés (Dimroth, 1981). Trois gènes structuraux oadA, oadB et oadG codant
43
respectivement pour les sous-unités  et sont organisés sur le chromosome dans le sens
de transcription oadGAB. Les gènes oadGAB de Klebseilla pneumoniae ont été clonés sur un
plasmide puis exprimés chez Escherichia coli (Di Beradino et al., 1996). Le transport Na+
dépendant a été étudié après reconstitution dans les protéoliposomes (Di Beradino et Dimroth,
1995 ; Di Beradino et Dimroth, 1996).
Les gènes du métabolisme anaérobie du citrate sont regroupés sur le chromosome en deux
groupes de gènes à sens de transcription divergents, citCDEFG et citS-oadGAB-citAB. Les
gènes citA et citB codes pour deux protéines régulatrices CitA (Sensor Kinase) et CitB
(Response Regulator), citS codes pour une protéine de transport du citrate nommée CitS.
Chaque groupe forme un opéron dont le promoteur est localisé sur la région intergénique citScitC (Fig. 12). Les enzymes responsables de la fermentation du citrate chez Klebseilla
pneumoniae sont induites dans des conditions d’anaérobiose et sont soumises à une répression
catabolique (Dagley et Dawes, 1953).
III.1.3. Chez Escherichia coli.
Escherichia coli possède une citrate lyase et se distingue des autres membres de la famille
des entérobactéries par son incapacité à utiliser le citrate en anaérobiose. Ceci a été attribué à
l’absence d’un système de transport fonctionnel. Cependant, certaines souches Escherichia
coli se révèlent capables de transporter le citrate en anaérobiose grâce à des systèmes de
transports plasmidiques. Ces plasmides sont retrouvés dans des variants naturels
d’Escherichia coli de phénotype citrate positif, isolés de sources humaines ou animales
(Ishiguro et al., 1978).
L’analyse du génome d’Escherichia coli, entièrement séquencé (Blattner et al., 1997), a
permis de localiser les gènes structuraux responsables de la fermentation du citrate (Fig. 13).
La comparaison avec l’organisation obtenue chez Klebseilla pneumoniae révèle que :
Le cluster citCDEFG est localisé sur le chromosome d’Escherichia coli. Le
fonctionnement des protéines codées par l’ensemble des gènes a été déduite des comparaisons
avec Klebseilla pneumoniae (Pos et al., 1998).
A la différence des résultats obtenus chez Klebseilla pneumoniae, les gènes citF, citG sont
séparés par une ORF désignée citX (Pos et al., 1998).
44
Citrate lyase
Oxaloacétate décarboxylase
Citrate
lyase Ligase
citG
citF
citE
citD
citC
Citrate
carrier
citS
oadG
oadA
oadB
Sensor
kinase
Response
regulator
citA
citB
Figure 12 : Organisation des gènes de la fermentation du citrate chez Klebseilla pneumoniae (Meyer et al., 1997).
Citrate lyase
Citrate
carrier
citT
citG
citX
citF
citE
Citrate
lyase Ligase
citD
citC
Sensor
kinase
Response
regulator
citA
citB
Figure 13 : Organisation des gènes de la fermentation du citrate chez Escherichia coli (Blattner et al., 1997).
45
III-2. Chez les bacteries lactiques.
Chez les bactéries lactiques, la majorité des études moléculaires a été réalisée chez le genre
Lactococcus. Ceci peut être attribué au peu d’outils génétiques adaptés aux autres genres
notamment Leuconostoc d’une part, et d’autre part, à la difficulté rencontrée pour les
transformations génétiques de ces souches.
Les gènes du transport du citrate décrits chez les bactéries présentent une hétérogénéité
dans leur localisation qui peut être plasmidique ou chromosomique. Chez les bactéries
lactiques, seuls des transporteurs à localisation plasmidique ont été décrits (Tableau 7).
III. 2.1 Chez Lactococcus lactis.
Le premier gène de citrate perméase d’une bactérie lactique fut cloné chez Lactococcus
lactis biovar. diacetylactis (David et al., 1990). Ce gène est localisé sur un plasmide de 7.9
Kb. Chez Leuconostoc lactis (Vaughan et al., 1995) et Leuconostoc mesenteroides subsp.
mesenteroides (Bandell et al., 1998), le gène du transport est localisé sur un plasmide de 23
Kb. Les protéines déduites ne se différencient que par la substitution de quelques acides
aminés. Leurs profils d’hydrophobicité sont identiques (Drider et al., 2004).
Chez Lactococcus, le gène citP est précédé de deux petites phases ouvertes de lecture qui
se chevauchent désignées citQ et citR. Ces ORFS coderaient pour des protéines de 33 et 112
acides aminés respectivement. L’ensemble est transcrit sur le même ARN messager, dont la
présence est indépendante de la présence du citrate dans le milieu (Lopez de Felip et al.,
1995). Cette organisation génétique n’a pas été retrouvée chez les Leuconostoc étudiés. Chez
Leuconostoc lactis, l’analyse des 200 pb en amont du gène citP a révélé la présence d’une
séquence similaire à citR de Lactococcus, mais dont la phase de lecture est interrompue à
plusieurs endroits par des mutations (Vaughan et al., 1995).
En amont de citQRP de Lactococcus, une phase ouverte de lecture a été identifiée comme
étant une séquence d’insertion IS982 (Lopez de Felip et al., 1995). Le cluster citQRP est
transcrit en un ARN messager de 2.9 Kb sous contrôle du promoteur P1 (Drider et al., 1998)
(Fig. 14). L’insertion de l’IS982 a introduit deux promoteurs supplémentaires P2 et P3. Alors
que P3 contrôle la transcription de l’IS982, P2 contrôle celle de citQRP. Le promoteur P’2 est
fonctionnel uniquement lors de l’expression de citP chez Escherichia coli. (Drider et al.,
1998). L’expression du gène citP seul est suffisante pour le mécanisme du transport du citrate.
Les auteurs suggèrent que citQRP font l’objet d’une régulation post-transcriptionelle
complexe où citQ et citR joueraient un rôle principale sur la régulation du niveau d’expression
de citP dans la cellule (Magni et al., 1994).
46
Tableau 7 : Localisation des gènes du transport du citrate chez les bactéries caractérisation de leurs produits.
Bactéries
Gènes
Produit du gène
Localisation
Références
Klebseilla pneumoniae
citS
citH
CitS 446 a.a.
CitH 444 a.a.
Chromosomique
Chromosomique
Schwarz et Oesterhelt, 1985
; Van Der Rest et al ., 1992
Van Der Rest et al ., 1990
Salmonella typhimurium
citC
CitC 446 a.a.
Chromosomique
Widenhorn et al., 1988
Escherichia coli
citA
citT
CitA 431 a.a.
CitT 487 a.a.
Plasmidique
Chromosomique
Ishiguro et Sato, 1985 ; Sasatu et
al., 1985
Pos et al., 1998
Bacillus subtilis
citM
CitM 433 a.a.
Chromosomique
Boorsma et al., 1996
Lactococcus lactis
citP
CitP 442 a.a.
Plasmidique
David et al., 1990
Leuconostoc lactis
citP
CitP 441 a.a.
Plasmidique
Vaughan et al., 1995
Leuconostoc mesenteroides
citP
CitP 443 a.a.
Plasmidique
Bandell et al., 1998
Weissella paramesenteroides
citP
CitP 443 a.a.
Plasmidique
Martin et al., 2000
47
P’2
P1
P2
citQ
IS982
citP
citR
P3
Figure 14 : Organisation génétique de la région en amont de citP chez Lactococcus lactis biovar. diacetylactis sur le
plasmide pCIT264 (Lopez de Felip et al., 1995).
P1, P2 et P’2 sont les promoteurs de transcription de citQRP ; P3 promoteur pour l’IS982.
citI
citM
citD
citC
citE
citG
citF
citR
citI : Protéine régulatrice.
citF : Sous unité 
citM : Enzyme malique.
citE : Sous unité 
citC : Citrate lyase ligase.
citR : Fonction inconnue.
citD : Acyl Carrier Protein.
citP : Citrate perméase.
citP
citG : Biosynthèse du groupe prosthétique de l’ACP
Figure 15 : Organisation des gènes de l’opéron citrate chez Weissella paramesenteroides
(Martin et al., 1999).
E coR V
citC
m ae
N deI
H in c II H in d III
c itE
citD
c itF
c itG
c itr a te ly a se
c ly R
c ly R
B clI
: p r o té in e r é g u la tr ic e p r é su m é e (3 1 2 a .a .)
m a e : e n zy m e m a liq u e (3 4 2 a .a .)
c itE :S o u s-u n ité  (3 0 2 a .a .)
c itF : S o u s-u n ité  (5 1 2 a .a .)
c itC : c itr a te ly a se lig a se (3 4 8 a .a .)
c itD : A c y l C a r r ie r P r o te in (9 7 a .a )
c itG : B io sy n th è se d u g r o u p e m e n t p r o s th é tiq u e d e l’A C P (4 6 7 a .a .)
Figure 16 : Organisation des gènes du locus citrate lyase chez Leuconostoc mesenteroides
subsp. cremoris 195 (Bekal et al., 1998).
48
III. 2. 2. Chez Weissella paramesenteroides.
Les gènes impliqués dans le métabolisme du citrate chez Weissella paramesenteroides ont
été clonés et séquencés par Martin et al., 1999. Ces gènes sont organisés dans un opéron
plasmidique de 8.8 kb nommé citMCDEFGRP (Fig. 15), l’étude de l’homologie des produits
des gènes citMCDEFGRP montre que citP code pour une citrate perméase 90% identique à
celles de Lactococcus lactis et Leuconostoc lactis, citC code pour une citrate ligase 47.8%
identique à celle de Leuconostoc mesenteroides, citDEF code pour les sous unités de la citrate
lyase 78% identique à celle de Leuconostoc mesenteroides (Martin et al., 1999).
L’analyse transcriptionnelle a révélée qu’un transcrit de la même taille que l’opéron
citMCDEFGRP est induit par l’addition du citrate dans le milieu de culture. En amont de cet
opéron se situ un gène nommé citI qui code pour une protéine régulatrice CitI (Martin et al.,
2000).
III. 2. 3. Chez Leuconostoc mesenteroides subsp. cremoris.
Dans toutes les souches de Lactococcus de phénotype citrate positif et Leuconostoc
examinées, le phénotype citrate était un caractère instable lié à la présence d’un plasmide.
Exception faite pour Leuconostoc mesenteroides subsp. cremoris, où les mutants citrate
négatif redeviennent spontanément citrate positif et aucun signale d’hybridation n’a été
obtenu en utilisant les gènes citP connus comme sonde (Kihal et al., 1996).
Les recherches réalisées dans notre laboratoire ont permis la caractérisation de 7 gènes
impliqués dans le métabolisme de l'acide citrique chez Leuconostoc mesenteroides subsp.
cremoris 195. Ces gènes sont regroupés sur le chromosome et appartiennent au locus: clyRmae-citCDEFG (Bekal et al., 1998) (Fig. 16). La citrate lyase codée par citDEF forme un
complexe fonctionnel de trois protéines: une sous unité  codée par citF, une sous unité 
codée par citE et une sous unité  codée par citD. L’activation de ce complexe par acétylation
est réalisée grâce à une citrate lyase ligase codée par citC. Le gène mae code pour une enzyme
malique NAD+- dépendante présumée, clyR code pour une protéine similaire aux régulateurs
de la famille SorC. En aval du cluster citCDEF le gène citG code pour une protéine CitG
identique au CitG de Klebseilla pneumoniae et responsable de la synthèse du groupement
prosthétique de la citrate lyase selon Schneider et al., (2000).
49
MATERIELS ET METHODES
Partie étude microbiologique
I. Les souches de bactéries lactiques utilisées.
Les différentes souches de bactéries lactiques étudiées proviennent de la collection du
Laboratoire de Microbiologie Alimentaire, de l’ENSBANA, Université de Bourgogne, Dijon
France. Ces souches sont des coccis mésophiles (28 °C à 30 °C).
Les principaux caractères de ces souches sont regroupés dans le tableau 8.
II. Milieux de culture :
II. 1. Le Milieu MRS. (De Man, Rogosa et Sharpe, 1960)
La richesse en sources d’énergies (citrate, glucose, acétate et parfois lactose) rend ce
milieu convenable à la plus part des bactéries lactiques, il est utilisé couramment pour la
culture de ces souches. L’addition de la vancomycine (25 g/ml) permet de sélectionner le
genre Leuconostoc (Mathot, et al., 1993)
II. 2. Le milieu M17 (Terzaghi et Sandine, 1975)
Par contre le milieu M17 avec sa composition en Lactose sans citrate favorise la bonne
croissance des lactocoques, pour les précultures et le dénombrement.
II. 3. Le milieu KmK. (Kempler et McKay, 1980)
Ce milieu permet de différencier entre les bactéries utilisant le citrate et donnant des
colonies de couleur bleues (Lactococcus lactis subsp diacetylactis et Leuconostoc ssp.) des
autres espèces qui n’utilisent pas le citrate et donnent des colonies blanches.
III. Fermentation des sucres
Utilisation des galeries Api 50 CH : les galeries Api 50 CH (BioMérieux) sont utilisées
pour tester la fermentation des sucres par les bactéries lactiques, elles comportent 49 sucres et
un contrôle (Fig. 17).
Le milieu MRS BCP est un milieu MRS sans sucre plus l’indicateur Pourpre de
Bromocresol à 25 mg/L, qui donne la couleur violet au milieu neutre, la production de l’acide
lactique dans la milieu donne une réaction révélée par le changement de couleur vers le jaune.
IV. Conservation des souches
Deux procédés sont utilisés dans notre recherche: la conservation à longue durée, les
souches sont conservées dans leurs milieux du culture additionnés de 30% de glycérol et
portés dans un congélateur (-80°C), et la conservation à courte durée; les souches sont
conservées sur MRS ou M17 agar, après les avoir incubés pendant 24 heurs à 28 °C, on les
porte au réfrigérateur à 4 °C, afin de garder la viabilité des souches et diminuer leur activité.
50
B
0
1
A
Control
Glycerol
2
Erythritol
3
D-Arabinose
4
L-Arabinose
5
Ribose
6
7
D-Xylose
L-Xylose
8
Adonitol
9
β Methyl-D-xyloside
10
Galactose
11
D-Glucose
12
13
F-Fructose
D-Manose
14
L-Sorbose
15
Rhamnose
16
Dulcitol
17
Inositol
18
19
Mannitol
Sorbitol
20
α Methyl-D-mannoside
21
α Methyl-D-glucoside
22
N Acetyl glucosamine
23
Amygdaline
24
25
Arbutine
Esculine
26
Salicine
27
Cellobiose
28
Maltose
29
Lactose
30
31
Melibiose
Saccharose
32
Trehalose
33
Inulin
34
Melezitose
35
Raffinose
36
37
Amidon
Glycogen
38
Xylitol
39
Gentiobiose
D-Turanose
40
41
D-Lyxose
42
43
D-Tagatose
D-Fucose
44
L-Fucose
45
D-Arabitol
46
L-Arabitol
47
Gluconate
48
49
2 ceto-gluconate
5 ceto-gluconate
Figure 17 : (A) photo d’une galerie Api 50 CH (Pour illustration);
(B) légende des sucres utilisés dans la galerie Api 50 CH.
51
Cette opération doit être répété régulièrement toutes les trois semaines. Parcontre les souches
réfférences sont conservées dans l’azote liquide (-156°C).
V. Réactivation et purification des souches
V. 1 Réactivation des souches :
La réactivation des souches de Leuconostoc et Lactococcus se fait sur milieu liquide
(MRS ou M17) dans un tube à contenance de 10 ml puis on les incube à 28 °C pendant 24
heures.
V. 2 Purification
Après avoir réactivé les souches sur milieu liquide, on prend une goutte de chaque culture,
qu’on ensemence sur milieu solide (MRS ou M17) par la méthode de stries. Puis on incube à
28°C pendant 24 à 48 heures.
VI- Caractérisation des souches
A) Caractères morphologiques :
Pour l’étude macroscopique la forme des colonies est observée sur les milieux solides.
L’étude microscopique de l'aspect morphologique des bactéries a été réalisé par la coloration
de Gram et par l’observation au microscope (Larpent et al., 1990).
B) Caractères physiologiques.
 Test de catalase: quelques gouttes d'eau oxygénée sont déposées sur les colonies
bactériennes, un dégagement gazeux traduit l'activité.
 Nature de la fermentation des sucres (hétérolatique ou homolatique): Un tube contenant
une cloche de Durham plus le milieu MRS glucosé est inoculé avec la souche étudiée, après
incubation de 24 h à 28 °C, la présence du gaz dans la cloche indique un métabolisme
hétérofermentaire.
 L'utilisation du citrate: La mise en évidence de l’utilisation du citrate est réalisée sur milieu
KmK (Kempler et Mckay, 1980). Les souches utilisatrices du citrate donnent des colonies
bleues.
52
Partie étude génétique
1. Souches bactériennes, milieux de culture, enzymes et oligonucléotides.
Les souches bactériennes, les enzymes de restriction et les oligonucléotides utilisés dans ce
travail sont présentées dans le tableau 8.
Les souches de Leuconostoc ont été cultivées sur milieu MRS (De Man et al, 1960) plus
Vancomycine (25 g/ml) à 28°C sans agitation. Lactococcus ont été cultivées à 30°C sans
agitation sur milieu M17 (Terzaghi et Sandine, 1975) qui contient 0,5% de glucose (M17G).le
phénotype citrate a été détecté sur milieu solide Kempler et Mckay (KMK agar) (Kempler et
McKay, 1980).
Tableau 8 : Souches, enzymes, oligonucléotides et plasmides utilisés dans cette étude.
Désignation
Caractéristiques
Référence
Souches bactériennes
Lac+ Cit-
Lactococcus lactis ssp. lactis IL 1403
Lc.mesenteroides ssp. cremoris 195
+
Chr. Hansen (France)
+
+
INRA, Jouy-en-Josas (France)
Lac Cit
Lc.mesenteroides ssp mesenteroides 19D
E. coli TG1
INRA,Jouy-en-Josas (France)
+
Lac Cit
supE hsd5 thi (lac-proAB) F’[traD36 proAB+ lacIq lacZM15]
Gisbson, 1984
Enzymes de restrictions
EcoRI
5’GAATTC 3’
Eurogentec
EcoRV
5’GATATC 3’
Eurogentec
HindIII
5’AAGCTT 3’
Eurogentec
PvuII
5’CAGCTG 3’
Eurogentec
ScaI
5’AGTACT 3’
Eurogentec
SmaI
5’CCCGGG 3’
Amersham LifeScience
Enzyme de ligation
T4 Ligase
Gibco BRL
Oligonucleotides
CPC2 (dégénéré)
5’ NACNGCNACRTTNGGNGTNCCNCCCAT 3’
Gibco BRL
CP1
5’ TAACAAACGAAAGAAGTTAATCCATGA 3’
Gibco BRL
CITP3
5’ TTCATCATTTTGTCAATTGTGTTAA 3’
Gibco BRL
5’ GTATTAGATTGAAAATACCACGT 3’
Gibco BRL
P3
P1
5’ TAGTGATGACAGCTGTTGGGA 3’
Gibco BRL
P2
5’ GCTACGATTTCAAAAGACAT 3’
Gibco BRL
Plasmides
pDL278
pGID075
Spectr
pDL278 avec citP de Lmc 195 sous contrôle du pLDH
Chan and Le blanc, 1992
Krantar et al., 2006
53
2. Techniques d’extraction et de purification des acides nucléiques.
Extraction et purification de l’ADN
L’extraction de l’ADN total de Leuconostoc a été réalisée selon la méthode décrite par
Sambrook et al. (1989). L’ADN plasmidique de Leuconostoc a été purifié selon la technique
de minipréparation en utilisant le Kit Qiagen (Tip 100, Qiagen, Courtaboeuf, France). La
purification d’ADN amplifié par PCR (Polymerase Chain Reaction) a été réalisée avec le Kit
JET pure (Genomed, Bad Oeynhausen, Allemagne). La purification d’ADN à partir du gel
d’agarose a été faite grâce au Kit JET sorb (Genomed, Bad Oeynhausen, Allemagne).
Protocole d’extraction de l’ADN totale de Lmc 195.
Culture de 30 ml sur MRS liquide.
1. Centrifuger à 5000 rpm / 5 min.
2.
Resuspendre le culot dans 400 l de solution 1 [TES + lysozyme +RNase] dans 2
tubes (vol. 1,5 ml) eppendrof de 200l chacun.
3.
Incuber 1 heure à 37°C.
4. Ajouter 200 l de solution 2 dans chaque tube eppendrof.
5. Mélanger doucement, ajouter 100 l de protéinase K (solution mère 10 mg/ml).
6. Mélanger doucement et incuber à 37°C O/N (14 heures de 18h à 8h).
7.
Ajouter 1 ml de phénol, vortexer puis centrifuger 10 min à 12000 rpm., (les protéines
restent dans la phase phénolique, la phase du haut) (Répéter 2 fois).
8. Récupérer la phase aqueuse qui contient l’ADN (Phase du bas).
9. Précipiter avec 500 l d’ isopropanol (l’ADN précipite).
10. centrifuger 1 min. à 12000 rpm.
11. Laver avec 500 l d’éthanol 70% froid.
12. Sécher au speed vac. (Appareil qui combine chaleur et sous vide).
13. Resuspendre le culot dans 50 l d’eau biomol (eau filtré + EDTA).
14. Doser l’ADN au spectrophotomètre à la fréquence 260 nm.
Solution 1: volume finale 50 ml
50 mM de Tris-HCl pH=8
05 Mm EDTA
20 % sucrose
20 mg/ml Lysozyme.
10U ou 50 g RNase
54
Solution 2 : volume final 50 ml.
10 mM de Tris-HCl
{0.5 ml de Tris-HCl pH=8 (1M)}
05 mM EDTA
{0.5 ml EDTA (0.5M)}
1 % de SDS
{2.5 ml SDS 20%}
46.5 ml d’eau autoclavé.
Protocole d’extraction d’ADN plasmidique de Lmc 195.
Culture de 10 ml sur MRS liquide.
1. Centrifuger 6 min à 6500 rpm.
2. Resuspendre le culot dans 200 l de TGE-Lysozyme {50 mM Tris-HCl pH=8 ;
EDTA 10mM ; Glucose 50 mM ; Lysozyme 10 mg/ml}.(Lyse Bacterienne).
3. Incuber 1 heure à 37°C, temps d’action du Lysozyme.
4. Ajouter 200 l de {NaOH 0.2N ; SDS 1X} mélanger doucement.
5. Incuber 10 min. à 4°C dans la glace.
6. Centrifuger 20 min. à 13000 rpm.
7. Récupérer le surnageant dans un nouveau tube eppendrof (vol. 1,5 ml).
8. Ajouter 54 l de Na-acétate (3M) et 550 l d’isopropanol.
9. Incuber 10 min. à température ambiante.
10. Centrifuger 25 min. à 13000 rpm.
11. Eliminer le surnageant et ajouter 1 ml éthanol 70% froid au culot. (Lavage).
12. Centrifuger 10 min. à 13000 rpm.
13. Eliminer éthanol. (étuve à 37°C).
14. Sécher au speed vac.
15. Resuspendre le culot dans 50 l d’eau biomol (eau filtré + EDTA).
Amplification de l’ADN (Fig. 18).
L’amplification de l’ADN est réalisée par PCR dans un milieu réactionnel contenant 0,5 U
de Taq DNA polymérase (Appligene, Illkirch, France), 10 l du tampon 10X de la Taq DNA
polymérase, 50 moles de chaque désoxynucléotide triphosphate et 0,5 mole de chaque
oligonucléotide synthétisé par Gibco BRL (Eragny, France). Le volume final de la réaction
est de 100 l. L’amplification est réalisée dans un thermocycler (Hybaid Omnigene,
Aubervilliers, France) en utilisant le programme suivant : dénaturation à 92°C (2 min.),
hybridation à 50°C (1 min.) puis élongation à 72°C (1 à 5 min. en fonction de la taille du
fragment à amplifier) pendant 25 cycles.
55
Séquence cible d’ADN à amplifier, 5’
amorces P1, P2 en excès, Taq DNA
3’
polymérase
3’
5’
Dénaturation de l’ADN à 92°C (2 min.)
Hybridation des amorces spécifiques
P1, P2 à 50 °C (1 min.)
P2
P1
Amplification : synthèse des brins
complémentaires par la Taq DNA
polymérase à partir des amorces
P1, P2 à 72°C (3 min.)
Dénaturation des duplexes néoformés
à 92 °C puis retour à 50°C
Reprise de la polymérisation du fait
de l’excès d’amorces. La répétition
de cycles de synthèse/hybridation
réalise une augmentation
exponentielle de la quantité initiale
d’ADN (à chaque cycle, le nombre
d’exemplaires de la séquence
encodée par les deux amorces
double)
Figure 18 : Schéma explicatif du principe de la PCR (Polymearse Chain Reaction).
56
Restriction et ligation
L’ADN a été digéré par les enzymes de restriction présentées dans le tableau 8 en utilisant
des tampons spécifiques dans les conditions recommandés par les fournisseurs.
La ligation des fragments d’ADN digérés a été réalisée dans un volume réactionnel de 1 ml
avec 5U de T4 ligase (Gibco BRL) dans du tampon 1X (50mM Tris-HCl pH 7,6 ; 10 mM
MgCl2 ; 1 mM ATP ; 1 mM DTT ; 25 % p/v polyethylene glycol-8000) selon les
recommandations du fabricant.
Extraction de l’ARN total
Les cellules de Leuconostoc ont été cultivées sur milieu MRS sans citrate jusqu’à une
densité optique égale à 0,8 (600 nm). Le citrate (citrate trisodique) est ajouté à une
concentration de 20 mM. Après 5 minutes d’induction par le citrate, 30 millilitres de culture
sont centrifugées (6000 tours par minute pendant 15 minutes à 4°C). Le culot obtenu est
utilisé pour l’extraction de l’ARN total par la méthode de Tri-reagent selon les
recommandations du fabriquant (Sigma, Aldrich, Germany).
Protocole de préparation de l’ARN total de Leuconostoc.
Préculture : Sur milieu MRS liquide sans extrait de viande ni citrate tri-sodique.
A
B
50 ml
50ml
DO=0.8
Ajout de citrate 3Na (2g/l) pour le flacon B
Laisser 1 heure puis arrêter la culture
Matériel:
La verrerie est passée au four 2 heures à 120°C.
L’eau est RNase free.
Tous les autres produits sont RNase free.
Tampon 10X :
20 ml de Na acétate (1M, pH=7)
40 ml MOPS 1M
04 ml EDTA 0.5 M
q.s.p. 200 ml eau RF.
57
GEL :
0.6 g d’agarose RF dans 36 ml d’eau RF. Chauffer et ajouter :
5 ml de tampon 10X
9 ml de Formaldehyde 37%
Extraction d’ARN :
1. Centrifuger 30 ml de chaque culture dans des corning tubes 15 minutes à 6000
rpm, à 4°C.
2. Reprendre le culot dans 1 ml de tri reagent froid (l’extrait).
3. Mettre avec précaution 200 mg de bielles RF 0,50 dans des tubes spéciaux, y mettre
l’extrait.
4. Casser 4 fois 1 minute en alternant dans de la glace.
5. Centrifuger 10 minutes à 12000 rpm, 4°C.
6. Récupérer le surnagent dans des tubes eppendrof RF.
7. Ajouter 0,2 ml de chloroforme.
8. Vortex 15 secondes et laisser 2 minutes à température ambiante.
9. Centrifuger 15 minutes à 12000 rpm, 4°C.
10. Transférer le surnagent dans de nouveaux tubes et ajouter 0,5 ml d’isopropanol
laisser 5 minutes à température ambiante (l’ARN précipite).
11. Centrifuger 10 minutes 12000 rpm, 4°C.
12. Laver avec 1ml d’éthanol 70% froid même les parois.
13. Centrifuger 5 minutes à 8000 rpm, 4°C.
14. Sécher au speed vac 2 minutes au maximum.
15. Reprendre dans 20l d’eau biomol. RF (RNase Free).
Echantillons :
30 g de RNA (2 l).
10 l Formamide.
04 l Formaldehyde 37%
02 l Tampon 10X
01l BrET
Chauffer 10 minutes à 65°C.
Gamme RNA (Marqueur) : Même traitement que l’ARN échantillons
Migration :
La migration se fait à 60 volts pendant 3 à 4 heures.
58
3. Techniques de manipulation et d’analyse des acides nucléiques.
Southern Blot
Après migration sur gel d’agarose (0,6 % p/v) dans du tampon TAE (40 mM tris acétate, 1
mM EDTA, pH 8,0) à 70 volts pendant 1 heure, l’ADN est transféré sur une membrane de
Nylon (Hybond-N, Amersham) selon la méthode décrite par Sambrook et al. (1989).
Protocole du Southern Blot :
Objectif : visualiser et cartographier un fragment du génome (ADN) dont on possède une
sonde.
Préparation de l'ADN à étudier
 Digestion par une enzyme de restriction adéquate
 Séparation des fragments par électrophorèse
 Dénaturation de l'ADN par incubation du gel d'électrophorèse dans une solution de soude
 Transfert de l'ADN sur une membrane de nitrocellulose ou de nylon par un flux de liquide
entraînant l'ADN.
 Fixation covalente de l'ADN sur la membrane par cuisson (Nitrocellulose) ou exposition
aux U.V (Nylon).
Préhybridation
Avant contact avec la sonde et avec la membrane, préincuber la membrane avec de l'ADN
neutre (ADN du sperme de Saumon) pour en éliminer tous les sites qui n'ont pas été saturés
par l'ADN bacteriens lors du transfert.
Protocole du marquage des sondes par PCR:
40 g de sonde.
1 l dCTP
1 l dGTP
1 l dTTP
0.5 l dATP32
1 l d'oligo X (50 pM/10 l)
1 l d'oligo Y (50 pM/10 l)
14 l d'eau autoclavé.
Programme PCR.
95°C 2 min.
50°C 1 min.
Ajouter 2,5 l de solution Taq /buffer.
59
Relancer
92°C
2 min.
50°C
1 min.
72°C
1 min.
10 cycles
Ajouter 1 l de dATP froid
72°C
10 min.
Hybridation
Ajouter la sonde dénaturée à la solution d'hybridation. La température d'hybridation étant
définie par la température de la sonde soit 65°C pour une sonde de + de 100 bases.
Lavages
Le lavage de la membrane a été réalisé à la même température d’hybridation par une
solution de lavage composé de SSC 20X (NaCl 2,5 M; citrate trisodique 280 mM; pH 7,0) à
différentes concentrations (5 % ; 4 % ; 2 % ; 1 % ; 0.5 %) et 0.1 % de SDS suivant les
recommandations de Sambrook et al., (1989).
Autoradiographie
La membrane est mise en contact avec un film photosensible.
Northern Blot
Après électrophorèse sur gel d’agarose (0,8 % p/v) contenant du formaldehyde 37 % (v/v),
l’ARN dénaturé est transféré sur une membrane de Nylon (Hybond-N, Amersham) selon les
recommandations de Sambrook et al. (1989).
Protocole du Northern Blot :
Le principe est le même que pour le Southern Blot mais ici ce sont les ARN qui sont étudiés.
Donc plus besoin de digérer par enzyme de restriction.
La visualisation d'un ARN par une sonde permet de :
 Apprécier sa distribution dans les tissus, étudier son abondance relative
 Déterminer sa taille
 Détecter les intermédiaires de maturation et les différentes formes coupures de l'ARN.
Hybridation
Les acides nucléiques transférés sur membrane ont été hybridés avec des sondes
homologues préalablement choisies. Ces sondes ont été marquées à l’[-32P]dATP
(Amersham) par PCR en utilisant le Profile Cycle Reader DNA Sequencing Kit (Fermentas).
L’hybridation a été réalisée à 68°C durant 14 heures, les lavages des membranes ont été
réalisés à la même température par une solution de lavage composé de SSC 20X (NaCl 2,5 M;
citrate trisodique 280 mM; pH 7,0) à différentes concentrations (5 % ; 4 % ; 2 % ; 1 % ; 0.5
%) et 0,1 % de SDS suivant les recommandations de Sambrook et al. (1989).
60
Southern Blot Schéma de la technique :
1-clivage enzymatique
(restriction enzymatique)
2- électrophorèse sur gel
d'agarose
3- transfert sur support solide
(membrane de nylon ou
nitrocellulose) par capillarité
(buvardage)
4- fixation de l'ADN sur la
membrane par cuisson (mb.
nitrocellulose) ou exposition
U.V (mb.nylon)
5- hybridation avec une
sonde marquée dénaturée
6- lavages
7- autoradiographie
61
4. Séquençage de l’ADN
Le séquençage a été réalisé selon la méthode de Sanger, (1977) en utilisant le Kit
(Thermosequenase radiolabelled terminator cycle sequencing, Amersham). Dans cette
méthode, ce sont les ddNTP (didésoxyribonucléotides triphosphates) marqués à l’[33
P]dATP qui s’incorporent et bloquent la thermosequenase DNA polymérase. L’élongation
est réalisée lors d’une PCR selon les recommandations du fabricant.
5. Utilisation du citrate par des cellules non proliférantes (resting cells)
L’utilisation du citrate par les cellules non proliférantes de Lmc 195 est étudié en présence
ou absence de glucose à deux pH différents 5,6 et 6,5.
Les cellules de Lmc 195 sont cultivées sur du bouillon MRS (50 ml) pendant une nuit à
30°C. Après centrifugation (6000 tours par minute pendant 15 minutes à 4°C), les cellules
sont lavées deux fois dans du tryptone sel puis resuspendues rapidement dans 20 ml de
tampon phosphate 200 mM, citrate 5 mM, glucose 2 mM, pH 6,5 et 5,6 de manière à obtenir
une densité optique à 600 nm égale à 1. Selon la présence ou non du glucose et les deux pH
choisis on a 4 suspensions. Les 20 ml de chaque suspension sont immédiatement incubés à
30°C sous agitation douce pendant 25 minutes. Les prélèvements (500 l) sont effectués
toutes les 5 minutes puis on centrifugés rapidement (14000 tours par minute pendant 15
secondes à 4°C). Trois cents microlitres (300 l) du surnageant sont immédiatement congelés
à -20°C jusqu’au moment du dosage du citrate.
Le citrate est dosé par la méthode UV selon les recommandations du fournisseur (kit
citrate, Boehringer Mannheim, Allemagne).
La vitesse spécifique d’utilisation du citrate est exprimée en h-1 (grammes de citrate
consommés par grammes de cellule et par heure). Dans notre cas 1 DO = 0,45 g de poid sec
de Lmc195 dans 1l de milieu.
62
RESULTATS
Etude Microbiologique
Pour vérifier l’authenticité et la pureté de la souche étudiée dans ce travail nous avons
procédés à une caractérisation microbiologique de la souche Leuconostoc mesenteroides
subsp cremoris 195 sur le milieu MRS vancomycine (25 g/ml).
I. 1 Aspect morphologique
L’examen macroscopique de la culture sur milieu MRS agar vancomycine après 24 h
montre des colonies généralement bien isolées. Elles sont ponctiforme de couleur blanchâtre à
pourtour régulier, surélevé et opaque; ces caractères culturels correspondent aux colonies des
Leuconostoc.
L’examen microscopique nous permet de vérifier la forme des cellules. Toutes les cellules
sont des coccis Gram positives, de forme lenticulaire, en diplocoques groupées en chaînettes
plus aux moins longues. L’uniformité des cellules confirme la purification parfaite des
souches étudiées.
I. 2 Aspect Physiologique :
 Test catalase : conformément au genre Leuconostoc ssp. notre souche est catalase
négatives.
 Type fermentaire : ce test clé donne une réponse franche sur la production du CO2. La
souche Lmc 195 est ensemencée sur milieu MRS vancomycine liquide glucosé sans citrate. Le
CO2 produit par la souche est capté par la cloche de Durham. Ce résultat est en conformité
avec le type hétérofermontaire de Lmc 195. La production du gaz carbonique à partir du
glucose est due à la présence de l’enzyme 6-phosphogluconate dehydrogénase (Cogan, 1980).
 L’utilisation du citrate : l’utilisation du citrate a été observée sur milieu Kempler et Mc
Kay (1981), toutes les colonies sont apparues en bleues, ce qui traduit l’utilisation du citrate
présent dans le milieu
I. 3. Test des galeries Api 50 CH
La souche Lmc 195 se caractérise par l’utilisation des 4 sucres suivants : D-Glucose,
Lactose, Galactose et le N-Acetyl glucosamine ; ce qui a été confirmé par le profile de la
galerie Api 50 CH obtenu (Tableau 9). L’identité physiologique de notre souche se résume
dans le tableau suivant :
63
Tableau 9: Résultats de la galerie Api 50 CH et des tests classiques de caractérisation.
Souche
GRAM
CATALASE
CITRATE
TYPE FERMENTAIRE
D-Glucose
Galactose
N-Acetyl Glucosamine
Lactose
Glycerol
Erythritol
D-Arabinose
L-Arabinose
Ribose
D-Xylose
L-Xylose
Adonitol
β Methyl-D-xyloside
F-Fructose
D-Manose
L-Sorbose
Rhamnose
Dulcitol
Inositol
Mannitol
Sorbitol
α Methyl-D-mannoside
Amygdaline
Arbutine
Esculine
Salicine
Cellobiose
Maltose
Melibiose
Saccharose
Trehalose
Inuline
Melezitose
D-Raffinose
Amidon
Glycogene
Xylitol
 Gentiobiose
D-Turanose
D-Turanose
D-Tagatose
D-Fucose
L-Fucose
D-Arabitol
L-Arabitol
Gluconate
2 ceto-gluconate
5 ceto-gluconate
Lmc 195
+
+
HETERO.
+
+
+
+
64
I. 4. Co-métabolisme sucre citrate chez Lmc 195.
Deux cultures de Lmc 195 ont été cultivées dans le milieu liquide MRS glucose après 5
heures, on ajoute le citrate (20g/L) à l’une d’eux. Les courbes de croissances obtenues
(Figure. 19) montrent un effet positif du citrate sur la croissance de Lmc 195.
I. 5- Utilisation du citrate par des cellules non proliférantes
L’effet du pH et du glucose sur la vitesse de consommation du citrate a été étudié sur des
cellules non proliférantes de Leuconostoc mesenteroides subsp. cremoris 195. Les résultats de
cette expérience sont représentés dans la figure 20.
En absence de glucose, le citrate est consommé à une vitesse spécifique de 2,91 h-1 à pH
6,5. Cette vitesse double dans les conditions de pH plus bas 5,6 (4,26 h-1).
En présence de glucose, à pH 6,5 la vitesse spécifique de consommation du citrate est de
4,38 h-1, et atteint 5,16 à pH 5,6. Donc, les cellules non proliférantes de Leuconostoc
mesenteroides subsp. cremoris 195 consomment plus vite le citrate à pH bas et/ou en présence
de glucose.
65
2,5
DO
2
1,5
Citrate
1
0,5
0
Temps (H)
0 1 2 3 4 5 6 7 8 9 10 11 12 14 16
Figure 19 : Courbe de croissance de Lmc 195 sur MRS avec induction par le citrate.
Lmc195 glucose+citrate
Lmc195 glucose
Citrate (g/l)
1,2
0,8
0,4
0
0
5
10
15
20
25
30
Temps (minute)
Figure 20. Métabolisme du citrate par des cellules non proliférantes de Lmc 195.
() Citrate pH 6,5 () citrate plus glucose pH 6,5 () citrate pH 5,6 () citrate plus glucose pH 5,6.
66
Etude Génétique
I. Séquençage et Analyse de la partie en aval du locus citCDEFG.
I. 1. Clonage et séquençage :
Le clonage de la partie en aval du locus citCDEFG a été réalisé en 3 étapes:
La première étape : consiste à utiliser la stratégie d’un clonage in vitro basée sur la
technique de PCR inverse (Fig. 21). Cinq microgrammes (5 g) d’ADN total de Leuconostoc
mesenteroides subsp. cremoris ont été digérés avec PvuII, puis ligués dans du tampon ligase
1X avec 5 U de T4 ligase dans un volume final de 1 ml. Une seconde digestion (HindIII) a été
réalisée afin de linéariser le fragment cible et de favoriser l’amplification avec les
oligonucléotides choisis P1 et P2.
Cette technique nous a permis d’amplifier un fragment d’ADN de 1,2 Kb en aval de citG.
Les oligonucléotides utilisés pour amplifier ce fragment d’ADN ont été utilisés pour
séquencer et analyser le fragment obtenu (1,2 kb).
La deuxième étape : nous avons opté pour une technique consistant à amplifier l’ADN de
Leuconostoc mesenteroides subsp. cremoris 195 par PCR avec deux oligonucléotides choisis
sur l’extrémité C-terminale d’une séquence protéique de la citrate perméase de Lactococcus
lactis subsp. lactis (CPC2 dégénéré) (Fig. 24) et (CP1) sur l’extrémité C-terminale de citO
(Fig. 22). Ces oligonucléotides ont également été utilisés pour le séquençage et l’analyse du
fragment obtenu.
Cette technique nous a permis d’amplifier un fragment d’ADN de 1174 pb en aval du gène
citO (Fig. 22) dont 1147 pb correspondant au gène citP. A ce stade d’investigation, 382 acides
aminés du gène citP sont connus. En comparant la séquence protéique obtenue avec les autres
CitP connues des bactéries lactiques, nous estimons qu’une soixantaine d’acides aminés de
l’extrémité C-terminale reste à découvrir.
La troisième étape : pour finir la séquence de citP, nous avons utilisés la stratégie de la
PCR inverse la même utilisée dans la première partie (Fig. 21) mais en utilisant les enzymes
de restriction suivants : EcoRV, pour la digestion de l’ADN et ScaI pour la linéarisation.
L’amplification a été effectuée par les oligonucléotides CITP3 et P3. (Fig. 22).
Cette technique nous a permis d’amplifier un fragment d’ADN de 2 Kb. Les
oligonucléotides utilisés pour amplifier ce fragment d’ADN ont été utilisés pour séquencer et
analyser le fragment obtenu (2 kb).
67
citG
PvuII
P1
P2
Digestion de l’ADN total par
PvuII
Circularisation par
ligature du mélange
HindIII
Linéarisation par
HindIII
P1
Amplification par PCR avec les
oligonucléotides
P2
1.2 Kb
Figure 21. Principe de la technique de PCR inverse (Technique utilisée au Laboratoire de Microbiologie
Alimentaire de l’ENSBANA, Université de Bourgogne. France.)
Région connus de l’ADN total.
Région d’ADN adjacente, à cloner.
Fragment d’ADN amplifié par PCR inverse.
68
I. 2. Analyse des séquences nucléotidiques.
Le séquençage et l’analyse des fragments obtenus ont révélé la présence de 3 phases
ouvertes de lecture dans le même sens de transcription que le locus citDEFG (Fig. 22).
La première phase ouverte est constituée de 795 pb. Un site de fixation ribosomique (RBS)
(GGTGG) et un codon d’initiation (ATG) présumés sont localisés aux positions (131-135) et
143 respectivement. Cette phase ouverte de lecture est interrompue par un codon stop (TGA)
à la position 938 et code ainsi pour une protéine de 265 acides aminés. Ce gène a été désigné
citO.
La deuxième phase ouverte de lecture est constituée de 1323 pb, elle débute par un codon
d’initiation de la traduction (ATG) à la position 1024 qui est précédé par un RBS
(AAAGAAG) (1010-1016). Cette phase ouverte de lecture est interrompue par un codon stop
(TAA) à la position 2346 et code ainsi pour une protéine de 441 acides aminés. Ce gène a été
désigné citP.
En aval du gène citP une troisième phase ouverte de lecture (252 pb) est identifiée. La
séquence de 84 acides aminés codés par cette ORF présente 21 % d'identité avec les
séquences d'insertion de la famille IS110. L'organisation de l'opéron citrate flanqué par deux
IS suggère l'existence d'un transposon composite.
Cette organisation chromosomique de l'opéron citrate est en accord avec celle rencontrer
chez d’autres bactéries lactiques mais à localisation plasmidique.
Les séquences de citO et citP sont déposés à la banque EMBL accessible sur le site
www.embl.com sous les références suivantes : citO AJ550521 citP AJ550522.
69
citG
AAATTGGTGGTAGTTACACACCAGAGGGGCTAAAGTTTCTCAATGATTTAGATCAAATGT 60
I G G S Y T P E G L K F L N D L D Q M
TTATTAAACGAAACCTTAGCATGGGCGGTGCGGCAGATAACTTAATTTTAACCATATTCT 120
F I K R N L S M G G A A D N L I L T I F
citO
RBS
TAGCAAGATTGGTGGGATCTTTATGAGTATGAGCTACATTGTGACAAACGATCACGTCAG 180
M S M S Y I V T N D H V R
L A R L V G S L *
ACTCGCTTACAGTGATGTTGGAGATGGTCCAACCATGATATTTTTACCGGGCTACTCTGA 240
L A Y S D V G D G P T M I F L P G Y S D
TATCAAAGAGACGTGGTATTTTCAATCTAAATACTTTTCCGAAAATGGGTACCGTATTAT
I K E T W Y F Q S K Y F S E N G Y R I I
TTGTTTGGACTGGAGAAGCCATGGGTGTTCAGCGCATACAGCCAAAAATATGAAAATCAT
C L D W R S H G C S A H T A K N M K I M
GCGTTTAGCTGCCGATTTGCACGAACTGATTACAACCTTAAAGTTAGAAAACGTCATTTT
R L A A D L H E L I T T L K L E N V I L
GATTGGTCATTCAATGGGTGCTAGTGTGATTTGGGCGTATGTGACAATATTTGGACAAAC
I G H S M G A S V I W A Y V T I F G Q T
GAATGTTAGCAAAATAATTACAGTCGACGAATCACCAAAACTAATTAATGATGTCGGTTG
N V S K I I T V D E S P K L I N D V G W
GCAAGCAGGCATCAAAAACCTTAATTGGGATAATTTTATTGAATTGGCACCGTTAATTTT
Q A G I K N L N W D N F I E L A P L I L
GCAGCAACCATTGACTGAACAGCAGATGCCAGCAACACTGAAAAATGTTCGTAATAGATT
Q Q P L T E Q Q M P A T L K N V R N R F
TAAAACAGATCATCCATTTGATGCTGATTTGGGATACGGACTACTATTAGATCATATGAA
K T D H P F D A D L G Y G L L L D H M K
ACAGGATTGGCGGAAAACCGTTATTAACATAACAGTTCCTCAATTATTTGTTGTCGGTGA
Q D W R K T V I N I T V P Q L F V V G D
TAAATCACCATTATGGGCAGGTGATTATAGTAAATATTGTGAAAAAAAGAGCAATATAAA
K S P L W A G D Y S K Y C E K K S N I K
ATTTTTTAAAACTTTAATTAAAAATACAGGGCACTTTCCGCAAATCGAAGACGCAGAGCG
F F K T L I K N T G H F P Q I E D A E R
CTTTAACAGTGAAATAAATTTTTTTCTTACAAATACTTGAATGATTAAAAGTATACAGTC
F N S E I N F F L T N T *
300
360
420
480
540
600
660
720
780
840
900
960
RBS
TATTTTTTTAAAAAATTTTAAGCATTATATGTGAATAAAATAACCAACGAAAGAAGTAA 1020
citP
CP1
TCCATGATAAACGAAAAAGAAACAAGCGGCAATAAGTCAAAGCTCAAAAGTGCTTTAGGT
M I N E K E T S G N K S K L K S A L G
GCTGTGGACAAAATTAAAATTAGTGGGATTGGATTGGTTGCTTATATTGTAATGGCTATT
A V D K I K I S G I G L V A Y I V M A I
CTTTTGATTGTAGCTATTAGTACTCATAAGTTACCCAATACAATGATTGGGGCCATTCTA
L L I V A I S T H K L P N T M I G A I L
GCTTTGGTTATTATGGGACATGTATTCTATTATATTGGGGCTCATTTACCAATTTTTAGA
A L V I M G H V F Y Y I G A H L P I F R
1080
1140
1200
1260
70
TCTTATTTGGGTGGTGGTTCAGTCTTTACAATATTAGTGATGGCTGTGTTGGTTTATCTC
S Y L G G G S V F T I L V M A V L V Y L
AACATAGTTCCTAGTTACACTGTAAAAACAGCATCAGGATTTATCAACGGCATGGACTTT
N I V P S Y T V K T A S G F I N G M D F
CTTGGTCTGTACATTGTTTCCCTTATAGGATCATCAATTTTTAAAATGAATCGTAAAATG
L G L Y I V S L I G S S I F K M N R K M
TTACTCAGTGCAGCTGTACGATTTTTACCAGTAGCATTTTTGTCAATGGCAGTTACTTTC
L L S A A V R F L P V A F L S M A V T F
TTCGGAGTGGGCTTAGTTGGTATGTTGATTGGTGTTGGATTTAGTCACGCAGTATTATAT
F G V G L V G M L I G V G F S H A V L Y
ACTAGTTTACCTATTATGGCCGGCGGAGTTGGCGCTGGTATTGTACCGCTTTCAGGTATT
T S L P I M A G G V G A G I V P L S G I
TATGCTCACGCCTTTGGTAGCTCTGCCTCAGTTGTTTTATCAAAATTATTCCCCGCCGTT
Y A H A F G S S A S V V L S K L F P A V
ATTTTTGGTAATTTGCTGGCTATTATTAGTGCCGGCCTTGTTTCTAAACTGTTCTTACAC
I F G N L L A I I S A G L V S K L F L H
AGCAAGTCAAATGGGCACGGCGTGTTACTGAAGACTGAAAATGCTGATGCGCAAGTCGTA
S K S N G H G V L L K T E N A D A Q V V
GCAGATCCCAAACCAGACTACACTCAAATAGGTGTTGGCTTGATCATATCCGTTTCTTTC
A D P K P D Y T Q I G V G L I I S V S F
TTTGTATTTGGCACACTCTTAAGTGCACTATTTCCATCAATCAATGCATACGCTTTCATC
F V F G T L L S A L F P S I N A Y A F I
ATTTTGTCAATTGTGTTAACAAAAGGATTGGGCTTGTTGCCTGAGTATTATGAACAGTCT
I L S I V L T K G L G L L P E Y Y E Q S
GTGATTATGTCCGGACAGGTGATTACTAAGAACATGACACATGCCTTGTTGGCAGGAGTG
V I M S G Q V I T K N M T H A L L A G V
GGAATGTCGTTAGTTAATATCAAACTTCTATTGAGTGCATTATCATGGCAGTTTGTGGTA
G M S L V N I K L L L S A L S W Q F V V
CTTTGCTTAACGAGTATTATTGTGATTTCATTGGCAAGTTATTTCCTCGGTAAATTGTTT
L C L T S I I V I S L A S Y F L G K L F
GGCTTATATCCAGTCGAGTCGGTCATTACTGCTGGTTTAGCTAATAATAGTATGGGCGGT
G L Y P V E S V I T A G L A N N S M G G
ACTGGCAATGTGGCTGTTTTGGCTGCTTCTGATAGGTTGAATTTGATTGCTTTTGCTCAA
T G N V A V L A A S D R L N L I A F A Q
ATGGGAAACCGTATTGGTGGGGCATTAGTTCTGGTTATAGCTGGCATACTTGTGTCGTTT
M G N R I G G A L V L V I A G I L V S F
ATGCATTAAAAGTTTTGACGGTTGCAAAGGAATATTAAGAAAAGCACAGCGTCGT
M H *
1320
1380
1440
1500
1560
1620
1680
1740
1800
1860
1920
1980
2040
2100
2160
2220
2280
2340
2395
Figure 22. Séquence nucléotidique et séquence en acides aminés déduite du gène citO et la
séquence complète du gène citP chez Leuconostoc mesenteroides subsp. cremoris 195.
Les sites présumés de fixation des ribosomes sont en rouge, les codons d’initiation de la
traduction sont en bleu. Les séquences de citO et citP sont déposés a la banque EMBL
accessible sur le site www.embl.com sous les références suivantes : citO AJ550521 citP
AJ550522.
71
II. Comparaison des séquences protéiques :
-II-1- Alignement de la séquence protéique citO
L’interrogation des banques protéiques (Genbank et Swissprot) montre des similarités de
séquences entre CitO, les
estérases et les serine-lipases. Comme la lipase et l’estérase
possèdent le même résidu de site actif (sérine), il semble difficile de distinguer par simple
identité protéique entre ces deux enzymes.
Ainsi la séquence protéique de CitO a été alignée à celle de cinq lipases/estérases issues de
cinq micro-organismes, retrouvées dans les banques protéiques (Fig. 23).
La fonction de CitO n'étant pas encore établie, son rôle dans le métabolisme du citrate peut
être discuté.
-II-2- Alignement de la séquence protéique citP
L’alignement des citrate perméases connues des bactéries lactiques montre une forte
identité entre les différentes séquences protéiques de l’ordre de 99 %. Ce qui laisse penser
qu’il s’agisse du même gène acquis par ces bactéries grâce a un transfert génétique
horizontale. De cette identité protéique résulte des profiles d’hydrophobicité également
identiques. Cependant, l’alignement de la séquence CitP de Leuconostoc mesenteroides
subsp. cremoris avec les autres citrate perméases montrent une identité de séquences ne
dépassant pas 70 % sur les 441 acides aminés connus (Fig. 24).
En effet, sur les 441 acides aminés alignés, on observe une conservation de 267 acides
aminés. Cependant, si les autres citrate perméases des bactéries lactiques s’alignent
parfaitement, l’extrémité N-terminale de Lmc 195 montre une divergence principalement
localisée au niveau des 25 premiers acides aminés. Il en résulte une différence au niveau des
profils d’hydrophobicité entre CitP de Leuconostoc mesenteroides subsp. cremoris et
Leuconostoc mesenteroides subsp. mesenteroides (Fig. 25).
L’extrémité N-terminale (25 premiers acides amines) des CitP des bactéries lactiques
(Leuconostoc mesenteroides subsp. mesenteroides ; Leuconostoc lactis ; Lactococcus lactis)
est de nature hydrophobe alors que chez Leuconostoc cremoris elle est de nature hydrophile.
Cette différence d’hydrophobicité peut être expliquée par la substitution de 11 acides aminés
dont 3 histidines acides aminés de nature hydrophobe (positivement) par 2 acides glutamiques
et une glycine de nature hydrophile (négativement) chez Leuconostoc mesenteroides subsp.
cremoris (Fig. 24).
72
Cette différence des propriétés entre les acides aminés joue sur celles de l’extrémité Nterminale de CitP de Leuconostoc mesenteroides subsp. cremoris et lui confère des propriétés
physico-chimique différentes.
HAEIN
ECOLI
LMC
MYCMY
MYCPN
MYCGE
MIFIFISLFAKIFFNYNDFFTNSHVKIMAKSLLNYQFHQVKQTINT-PVLIFIHGLFGDM
------------------------------MKLNIRAQTAQNQHNN-SPIVLVHGLFGSL
-------------------------MSMSYIVTNDHVRLAYSDVGDGPTMIFLPGYSDIK
-----------------------------MNLIYDYNYVFKNNNNDNENIIFVHGYNSSP
---------------------------MRLEIENGLEFVCDPFLNERGKIFFLHAFTGNI
--------------------MKRFSDLNQIDISKLEVFFQPAKKTKKQTVVFAHGFSVFH
59
29
33
31
33
40
HAEIN
ECOLI
LMC
MYCMY
MYCPN
MYCGE
DNLGVIARAFSEH-YSILRIDLRNHGHSFH---SEKMNYQLMAEDVIAVIRHLNLSKVIL
DNLGVLARDLVND-HNIIQVDMRNHGLSPR---DPVMNYPAMAQDLVDTLDAQQIDKATF
ETWYFQSKYFSENGYRIICLDWRSHGCSAHT--AKNMKIMRLAADLHELITTLKLENVIL
RTFEYLKNIQQDQ--IIMHYNFQDQIYVKPVK-DHKVTVEGFAQLLIHFIEQNQIKNVVA
TNKLSFRTHFKDY--SFYGINFPGHGNSVIHN-QSELDFNFWIKLVQQFFNKYQLKNVVL
SYFQSFYKTLTDY--DYYAPLWPGHNVNGFD--YKELSPIHYGELLAAFIENKDLENIVL
115
85
91
88
90
96
HAEIN
ECOLI
LMC
MYCMY
MYCPN
MYCGE
IGHSMGGKTAMK-ITALCPELVEKLIVID--MSP-MPYEGFGHKDVFNG------LFAVK
IGHSMGGKAVMA-LTALASDRIDKLVAID--IAP-VDYHVRRHDEIFAA------INAVS
IGHSMGASVIWAYVTIFGQTNVSKIITVD--ESP-KLINDVGWQAGIKN------LNWDN
IGHSMGGGVISI-RYKMRPDLFKKLIFITPMNKPQRALYEQYKIDYFPK------TFEEY
FGHSIGGGLAIALTQVLTKEQIKGIILEAPLNPGIRATPPSIISALVPD------TNEDF
IGHSMGAAVCSYAMNLLNAKRVEKLILLA----P-LSYCNLLRYFKIKS------SFKKD
165
135
142
141
144
145
HAEIN
ECOLI
LMC
MYCMY
MYCPN
MYCGE
NAKPENRQQAKPILKQEI--NDEDVVQFMLKSFDVNSADCFRFNLTALFNNYANIMDW-E
ESDAQTRQQAAAIMRQHL--NEEGVIQFLLKSFVDG---EWRFNVPVLWDQYPHIVGW-E
FIELAPLILQQPLTEQQM----PATLKNVRNRFKTDH--PFDADLGYGLLLDHMKQDWRK
INNTLSSLYYDPSILTSN----KEWMEKAKQEFDPYVY-NNDVIVELGEPKDRTFELIEQ
EAVQRALIYNIEQRFGAN---FKDFCAKQKQKMIQKYA-PLKVMLQP-EQAEQRLQLIDA
KAERMANFKAMFQTKFSN-----LTDENSWENELSK---HSKMAKKLSNNILKELPVLNK
222
189
196
196
199
197
HAEIN
ECOLI
LMC
MYCMY
MYCPN
MYCGE
KVRVFT-PTLFIKGGNSSYIKIENSEKILEQ--FPNATAF--TINGSGHWVHAEKPDFVI
KIPAWDHPALFIPGGNSPYVSEQYRDDLLAQ--FPQARAH--VIAGAGHWVHAEKPDAVL
TVINITVPQLFVVGDKSPLWAGDYS-KYCEK--KSNIKFFKTLIKNTGHFPQIEDAERFN
GLDAIKIPSLLILGEKDGVILRDECLKYFDQH-VKGVEMH--WMKKTGHMVFQENFDEFI
AFKRLSYPTLWIHGQEDGIVRYLPSKAYLES--LHNPLIELVGLSNTAHTTFFEQPQQFL
TYKNLKLPVFLVLAQNDLFMPTKLTLSYFNKYLIKNNNLQSSVILNSEHQMFNSKYESFC
277
245
253
253
257
257
HAEIN
ECOLI
LMC
MYCMY
MYCPN
MYCGE
RAIKRFLNKN-----RAIRRYLND------SEINFFLTN------KIVENFLNKTN----QLVEQFLNKLNK---KAMDDILNHNKLSKIY
287
254
262
264
269
273
Figure 23 : Alignement multiple des lipases/estérases de différents
microorganismes avec la protéine CitO de Leuconostoc mesenteroides subsp.
cremoris 195.
HAEIN : Haemophilus influenzae, Q57427 (Fleischmann et al., 1995).
ECOLI : Escherichia coli, P75736 (Blattner et al., 1997).
LMC : Leuconostoc mesenteroides subsp. cremoris (CitO) (Krantar et al., 2006)
MYCMY : Mycoplasma mycoides, AAA95964 (Rawadi et al., 1995).
MYCPN : Mycoplasma pneumoniae, P75333, (Himmelriech et al., 1996).
MYCGE : Mycoplasma gelitanium, AAC71569 (Fleischmann et al., 1995).
La signature des lipases/esterases est sur fond jaune. Le résidu serine représente le site actif.
Les chiffres a droite indiquent la position des acides aminés dans chacune des séquences.
Le logiciel Multiple Align programme (Corpet, 1988) a été utilisé pour réaliser l’alignement multiple.
73
Lmm.
Lnl.
Lcl.
Lmc.
-MMNHPHSSHIGTTNVKEEIGKLDRIRISGIGLVRYAFMAVLLIIAISTKTLPNTMIGAI
-MMNHPHSSHIGTTNVKEEIGKLDRIRISGIGLVAYAFMAVLLIIAISTKTLPNTMIGAI
-MMNHPHSSHIGTTNVKEEIGKLDRIRISGIGLVRYAFMAVLLIIAISTKTLPNTMIGAI
-MINEKETSGN-KSKLKSALGAVDKIKISGIGLVAYIVMAILLIVAISTHKLPNTMIGAI
59
59
59
59
Lmm.
Lnl.
Lcl.
Lmc.
FALVLMGHVFYYLGAHLPIFRSYLGGGSVFTILLTAILVATNVMPKYVVTTASGFINGMD
FALVLMGHVFYYLGAHLPIFRSYLGGGSVFTILLTAILVATNVMPKYVVTTASGFINGMD
FALVLMGHVFYYLGAHLPIFRSYLGGGSVFTILLTAILVATNVMPKYVVTTASGFINGMD
LALVIMGHVFYYIGAHLPIFRSYLGGGSVFTILVMAVLVYLNIVPSYTVKTASGFINGMD
119
119
119
119
Lmm.
Lnl.
Lcl.
Lmc.
FLGLYIVSLIASSLFKMDRKMLLKAAVRFLPVAFISMALTAVVIGIVGVIIGVGFNYAIL
FLGLYIVSLIASSLFKMDRKMLLKAAVRFLPVAFISMALTAVVIGIVGVIIGVGFNYAIL
FLGLYIVSLIASSLFKMDRKMLLKAAVRFLPVAFISMALTAVVIGIVGVIIGVGFNYAIL
FLGLYIVSLIGSSIFKMNRKMLLSAAVRFLPVAFLSMAVTFFGVGLVGMLIGVGFSHAVL
179
179
179
179
Lmm.
Lnl.
Lcl.
Lmc.
YIAMPIMAGGVGAGIVPLSGIYAHAMGVGSAGILSKLFPTVILGNLLAIISAGLISRIFK
YIAMPIMAGGVGAGIVPLSGIYAHAMGVGSAGILSKLFPTVILGNLLAIISAGLISRIFK
YIAMPIMAGGVGAGIVPLSGIYAHAMGVGSAGILSKLFPTVILGNLLAIISAGLISRIFK
YTSLPIMAGGVGAGIVPLSGIYAHAFGSSASVVLSKLFPAVIFGNLLAIISAGLVSKLFL
239
239
239
239
Lmm.
Lnl.
Lcl.
Lmc.
DSKGNGHGEILRGEREDAAAAAEEIKPDYVQLGVGLIIAVMFFMIGTMLNKVFPGINAYA
DSKGNGHGEILRGERED--AAAEEIKPDYVQLGVGLIIAVMFFMIGTMLNKVFPGINAYA
DSKGNGHGEILRGEREDAAAAAEEIKPDYVQLGVGLIIAVMFFMIGTMLNKVFPGINAYA
HSKSNGHGVLLKTENAD-AQVVADPKPDYTQIGVGLIISVSFFVFGTLLSALFPSINAYA
299
299
299
299
Lmm.
Lnl.
Lcl.
Lmc.
FIILSIVLTKAFGLLPKYYEDSVIMFGQVIVKNMTHALLAGVGLSLLDMHVLLAALSWQF
FIILSIVLTKAFGLLPKYYEDSVIMFGQVIVKNMTHALLAGVGLSLLDMHVLLAALSWQF
FIILSIVLTKAFGLLPKYYEDSVIMFGQVIVKNMTHALLAGVGLSLLDMHVLLAALSWQF
FIILSIVLTKGLGLLPEYYEQSVIMSGQVITKNMTHALLAGVGMSLVNIKLLLSALSWQF
359
359
359
359
Lmm.
Lnl.
Lcl.
Lmc.
VVLCLVSIVAISLISATLGKLFGLYPVEAAITAGLANNSMGGTGNVAVLAASERMNLIAF
VVLCLVSIVAISLISATLGKLFGLYPVEAAITAGLANNSMGGTGNVAVLAASERMNLIAF
VVLCLVSIVAISLISATLGKLFGLYPVEAAITAGLANNSMGGTGNVAVLAASERMNLIAF
VVLCLTSIIVISLASYFLGKLFGLYPVESVITAGLANNSMGGTGNVAVLAASDRLNLIAF
419
419
419
419
Lmm.
Lnl.
Lcl.
Lmc.
AQMGNRIGGALILVVAGILVTFMK
AQMGNRIGGALILVVAGILVTFMK
AQMGNRIGGALILVVAGILVTFMK
AQMGNRIGGALVLVIAGILVSFMH
443
443
443
443
CPC2
Figure 24 : Alignement de la citrate perméase des bactéries lactiques.
Lcl. : Lactococcus lactis NCDO176, N° d’accession 149369 GenBank
Lnl. : Leuconostoc lactis NZ6070, N° d’accession 1583536 GenBank
Lmm.: Leuconostoc mesenteroides subsp. mesenteroides 19D, N° d’accession 623057 GenBank
Lmc. : Leuconostoc mesenteroides subsp. cremoris 195, N° d’accession AJ 550522 EMBL.
Les lettres bleues représentent les acides aminés substitués chez Leuconostoc mesenteroides
subsp. cremoris 195.
74
Échelle
d’hydrophobicité
des
Acides Aminés
Position des acides aminés
Figure 25: Comparaison des profils d’hydrophodicité de la CitP de Lmm et la séquence
partielle de CitP de Lmc selon la méthode de Hoop et Woods, (1981).
-III- Caractérisation de la citrate perméase de Leuconostoc mesenteroides ssp. cremoris.
-III- 1- Localisation de la citrate permease de Lmc 195.
Chez toutes les souches appartenant aux genres Lactococcus et Leuconostoc, le
déterminant génétique du transport du citrate est localisé sur un plasmide de 23 kb. (Lin et al.,
1991). Les résultats obtenus nous ont permis de décrire la première citrate perméase à
localisation chromosomique chez la bactérie lactique Leuconostoc mesenteroides subsp.
cremoris. Afin de vérifier le nombre de copies et la localisation du gène citP, nous avons
réalisé une hybridation sur ADN total et plasmidique de Leuconostoc mesenteroides subsp.
cremoris en utilisant comme sonde l’extrémité N-terminale de citP (250pb).
Les résultats obtenus montrent que citP est présent en une seule copie et est localisé sur le
chromosome (Fig. 26). L’hybridation hétérologue entre citP de Leuconostoc mesenteroides
subsp. cremoris 195 et Leuconostoc mesenteroides subsp. mesenteroides 19D a permis de
confirmer la localisation de la citrate perméase de 19D sur le plasmide natif de 23 Kb(Fig.27).
75
A
B
A
1
2
3
4
1
2
3
4
1
2
3
1
B
2
3
23 kb
4 kb
1 kb
Figure 26. Profil de l’ADN plasmidique et de l’ADN
total de Leuconostoc mesenteroides subsp. cremoris
195 (A) et Hybridation avec la sonde citP de la
même souche (B).
1 : Plasmides natifs de Lmc 195
2 : Digestion d’ADN total avec ScaI/EcoRV
3 : Digestion avec SmaI
4 : Digestion avec PvuII
Sur la piste 3 l’ADN n’a pas bien transféré a cause des
gros fragments que produit la digestion de SmaI
Figure 27. Profil de l’ADN plasmidique
natif et digéré de Leuconostoc
mesenteroides subsp. mesenteroides 19D
(A) et Hybridation avec la sonde citP de
Leuconostoc cremoris 195 (B).
1 : Plasmides natifs de Lmm 19D
2 : Plasmides digérés par EcoRI
3 : Plasmides digérés par HindIII
-III-2- Expression hétérologue de citP chez Lactococcus lactis subsp. lactis IL1403 :
Le gène citP a été cloné dans le plasmide pDL278 qui peut s’exprimer chez les lactocoques
et Spectinomycine résistant sous le contrôle du promoteur de la lactate déshydrogénase
(pLDH) pour donner le plasmide recombinant pGID075. Ce dernier a été introduit par
électroporation chez la souche Lactococcus lacits subsp. lactis biovar. diacetylactis IL1403
(citP-) (Bourel et al., 1996). Les cellules de IL1403 transformés par le pGID075 ont été
étalées sur milieu KmK agar plus Spectinomycine (200 g/ml).
Les détailles de la construction du vecteur pGID075 sont représentés dans la figure 31.
Construction de la cassette pLDH-citP : selon la technique décrite par Elagöz et al., (1996).
 Amplification du pLDH de Lactococcus lactis par des amorces spécifiques A1 A2
 Amplification du citP de Lmc 195 par des amorces spécifiques B1 B2
76
5’
3’
5’
citP
pLDH
3’
A1
A2
B1
B2
Ligation par la T4 ligase
Sélection de la cassette pLDH-citP en amplifiant par PCR le fragment A1B2 en utilisant les amorces du même
3’
5’
pLDH
citP
A1
B2
Cloner la cassette pLDH-citP dans le site SmaI du plasmide pDL278, Ouverture du pDL278 par SmaI dans le
multiclonal sites (m.c.s.) et ligation de la cassette pLDH-citP avec le pDL278 ouvert par la T4 ligase.
SmaI
R
mcs
E. coli ori
U
pDL278
6,6 kb
Spect
E. coli ori
Transformer dans E. coli TG1, cribler dans le milieu L.B. Spect., vérifier l’orientation du bon sens
avec les couples d’amorces A1R, B2U afin d’isoler le bon clone qui contient le vecteur pGID075.
pGID075
Spect
Figure 28 : Construction du plasmide pGID075 selon la technique décrite par Elagöz et al., (1996).
77
Les résultas sont représenté dans les tableaux suivants :
Tableau 10 : Expression hétérologue chez la souche Lactococcus lactis subsp. lactis IL1403 :
Souches
Apparence sur KmK
Colonies blanches
IL1403
IL1403/pGID075
Colonies bleus
Tableau 11: Les activités spécifiques de la Citrate Lyase et la Lactate Déshydrogénase
(U/mg)
IL1403
IL1403/PGID075
LDH
10,33  0,06
9,67  0,07
CL
1,63  0,09
1,35  0,12
-IV- Analyse transcriptionnelle :
Chez Leuconostoc paramesenteroides on retrouve la même organisation des gènes du
métabolisme du citrate sur un plasmide de 22 kb. Un transcrit polycistronique de 8,8 kb est
détecté par Northern blot en présence de citrate (Martin et al., 2000).
Par contre chez Leuconostoc mesenteroides subsp. cremoris 195 l’analyse transcriptionelle
du locus citrate lyase a révélée que mae, citCDEF sont co-transcrits en un ARN messager de
5,2 kb détecté uniquement lorsque les cellules sont cultivées en présence de citrate. En ce qui
concerne citG, citO et citP, ils sont transcrits sur un messager de 4 kb détecté uniquement en
présence de citrate (Fig. 29).
La méthode de RT-PCR nous a permis de mettre en évidence un grand transcrit indécelable
par Northern blot qu’on a pu mettre en évidence par RT PCR (Fig. 30).
Le deuxième transcrit de 4 kb pourrait être le résultat d'une hydrolyse du grand transcrit ou
un ARN messager synthétiser de novo. En perspective de ce travail et pour vérifier cette
hypothèse nous pouvons adaptée la méthode décrite par Bensing et al., (1996) qui permet de
distinguer entre les ARN messagers synthétisés de novo (extrémités 5' triphosphatées) et les
ARN messagers hydrolysés (extrémités 5' monophosphatées).
78
Sonde Sonde
1
2
M
Cit -
Cit + Cit +
9,5 kb.
8,5 kb
8 kb
7,5 kb
6 kb.
5,5 kb.
5,2 kb
4 kb
0,24 kb.
Figure 29 : Northern blot l’ARN a été hybridé avec les sondes 1 et 2
localisées sur les fragments maecitCDE et citGOP respectivement où
M est le marqueur d’ARN 0,24-9,5 kb
5,2 Kb
4 Kb
Deux transcrits détectés par Northern blot en présence du citrate.
IS3
clyR
mae
citC
citD
citE
Sonde 2
citF
GZ
citG
GY
citO
citP
IS110
Sonde 1
Transcrit détecté par RT-PCR (GZ GY) en présence du citrate.
Figure 30 : Organisation génétique et transcriptionnelle des gènes du métabolisme du
citrate chez Leuconostoc mesenteroides subsp. cremoris 195. Les sondes 1 et 2 sont
utilisées pour le Northern blot
79
DISCUSSION
Notre étude concerne la caractérisation des gènes impliqués dans le métabolisme du citrate
chez Leuconostoc mesenteroides subsp. cremoris 195. Nos recherches nous ont permis
d’identifier trois gènes localisés à proximité du locus de la citrate lyase. Ces gènes codent
pour une protéine de transport appelé CitP, une protéine appelée CitO dont le rôle dans le
métabolisme du citrate n’est pas clairement identifié et une séquence d’insertion appartenant à
la famille des IS110.
Description d’un premier transporteur de citrate à localisation chromosomique chez une
bactérie lactique
Chez les bactéries lactiques la citrate perméase a été caractérisée chez la bactérie lactique
homofermentaire Lactococcus lactis subsp. lactis biovar. diacetylactis et les bactéries
hétérofermentaires Leuconostoc mesenteroides subsp. mesenteroides, Leuconostoc lactis et
Weissella paramesenteroides. Le gène de la citrate perméase est localisé sur un plasmide chez
les différentes souches étudiées voir tableau 12. Cependant, cette propriété à métaboliser le
citrate et donc à produire les composés aromatisants est un caractère instable, en raison de la
perte possible du plasmide citrate. (Kihal et al., 1996).
La souche Leuconostoc mesenteroides subsp. cremoris 195 nous offre un modèle génétique
différant de celui rencontré chez les autres bactéries lactiques étudiées. Le gène de la citrate
perméase citP est à localisation chromosomique, ce qui explique la stabilité du caractère
citrate observé chez cette sous-espèce.
Cependant, si les autres citrate perméases des bactéries lactiques (Leuconostoc
mesenteroides subsp. mesonteroides ; Leuconostoc lactis ; Lactococcus lactis) sont identiques
à 99% (Lhotte et al., 1995, Vaughan et al., 1995 ; David et al., 1990), celle de Leuconostoc
mesenteroides subsp. cremoris 195 ne présente que 70 % d’identité. Cette divergence est
concentrée au niveau des 25 premiers acides aminés de la partie N-terminale. Il en résulte une
différence nette du profil d’hydrophobicité au niveau de l’extrémité N-terminale. Elle est de
nature hydrophile chez Leuconostoc mesenteroides subsp. cremoris 195, mais hydrophobe
pour les autres bactéries lactiques. Par sa nature hydrophile, l’extrémité N-terminale de CitP
de Leuconostoc mesenteroides subsp. cremoris 195 est similaire à celle de CitS de Klebsiella
pneumoniae et CitC de Salmonella typhimurium (Bott, 1997; Ishiguro et al., 1992).
Les résultats des travaux effectués sur l’influence du pH sur le métabolisme du citrate
divergent selon les souches étudiées. Chez Lactococcus lactis subsp. lactis biovar.
diacetylactis une forte utilisation du citrate a été observée à pH acide 4,5 (Magni et al., 1999).
80
En revanche chez Leuconostoc mesenteroides subsp. mesenteroides aucune influence du pH
n’a été observée (Belguendouz et al., 1996). Dans ce travail une amélioration de l’utilisation
du citrate a été observée sous des conditions de pH acide 5,6 ainsi q’une forte utilisation de
citrate en présence du glucose.
Tableau 12: Localisation des gènes du transport du citrate chez les bactéries lactiques
étudiées.
Bactéries
Lactococcus lactis
Gène
citP
Localisation
plasmide de 7.9 kb
Références
David et al., 1990
Leuconostoc
mesenteroïdes
citP
plasmide de 23 kb
Lhotte et al., 1995
Leuconostoc lactis
citP
plasmide de 23 kb
Vaughan et al., 1995
Weissella
paramesenteroïdes
citP
plasmide de 22 kb
Martin et al., 1999
Leuconostoc
cremoris195
citP
chromosomique
Krantar et al., 2006
Organisation des gènes de la fermentation du citrate chez les bactéries.
Chez tous les microorganismes capables d’utiliser le citrate en anaérobiose et ayant fait
objet d’un travail de recherche ciblé (Klebsiella pneumoniae) (Bott et al,. 1995) ou d’un
séquençage systématique (Escherichia coli, Haemophilus influenzae) (Blattner et al., 1997 ;
Fleischmann et al,.1995), les gènes du métabolisme du citrate sont regroupés sur un même
fragment d’ADN (Fig. 31).
Chez les entérobactéries, l’exemple le plus complet reste celui de Klebsiella pneumoniae
où les gènes du transport du citrate citS de son clivage citCDEF et ceux de l’oxaloacétate
décarboxylase sont regroupés sur le chromosome (Bott, 1997). Escherichia coli offre par
similarité protéique la même organisation, sauf pour l’oxaloacétate décarboxylase dont
l’activité est absent chez cette espèce. (Blattner et al., 1997). Chez Haemophilus influenzae,
on retrouve sur le chromosome les gènes codant pour l’activité citrate lyase et la citrate lyase
ligase citCDEFG un gène sodiT1 de transport oxoglutarate/malate similaire à 35% avec le
transporteur CitT de Escherichia coli et dont le transport du citrate a été confirmé (Pos et al.,
1998). (Fig. 31).
Par contre, les espèces du genre Lactococcus offrent un autre modèle, où la citrate
perméase est plasmidique chez les souches capables d’utiliser le citrate et la citrate lyase est
81
A
clyR
IS3195
mae
mae
als
B
citI
C
citC
mleP
citM
citD
citE
clyR
citC
citG
citF
citC
citD
citD
citE
citG
citF
citQ
IS982
citA
citB
oadB
oadA
oadG
F
G
citS
citD
citC
citC
citD
citC
citE
citE
citD
citP
citF
citE
D
E
citO
citG
citP
citR
citP
citG
sodiT1
citG
citF
Phage
citR
citF
citF
citE
IS110
citX
citG
Figure 31 : Organisation des gènes du métabolisme du citrate chez différentes espèces bactériennes.
(A) Chromosome: Leuconostoc mesenteroides subsp. cremoris 195 (Bekal et al., 1998 les gènes IS3195clyRmaecitCDEFG et Krantar et al., 2006 les gènes citOPIS110).
(B) Chromosome: Lactococcus lactis IL 1403 (Bolotin et al., 2001)
(C) Plasmide: Weissella paramesenteroides (Martin et al., 2000)
(D) Plasmide: Lactococcus diacetylactis (Drider et al., 1998)
(E) Chromosome: Klebeilla pneumoniae (Bott, 1997)
(F) Chromosome: Haemophilus influenzae (Fleischmann et al., 1995)
(G) Chromosome: Escherichia coli (Blattner et al., 1997)
82
chromosomique. Ainsi, Lactococcus lactis subsp. cremoris MG1363, souche incapable
d’utiliser le citrate même après apport du gène du transport citP, contient une citrate lyase
chromosomique inactive, dont les sous unités étaient mises en évidence par immunoblot
(Bourel et al., 1995).
Chez Lactococcus lactis subsp. lactis IL1403, la capacité à utiliser le citrate peut être
restaurer par introduction du gène citP (Bourel et al., 1995). Les gènes de la citrate lyase sont
regroupés sur le chromosome à proximité des gènes clyR, mae (enzyme malique), mleP
(malate perméase) et als (acétolactate synthase) (Fig. 31).
Lactococcus lactis subsp. lactis biovar diacetylactis est la seule sous espèce de
Lactococcus qui est capable d’utilise le citrate naturellement. Le gène de la citrate perméase
est localisé sur un plasmide de 7.9 kb. (Lopez de Felipe et al., 1996). Par analogie à son
mutant IL1403 la citrate lyase serait chromosomique.
Leuconostoc mesenteroides subsp. cremoris 195 nous offre un modèle proche des
entérobactéries dans son organisation. Sur le même fragment d’ADN chromosomique, sont
rassemblés les gènes impliqués dans l’activité citrate lyase citCDEFG, un gène de régulation
clyR (Bekal et al., 1999), un gène de transport citP (Krantar et al., 2006) ainsi que d’autres
gènes dont le rôle dans le métabolisme du citrate reste à élucider (Fig. 31).
Chez Weissella paramesenteroides on retrouve la même organisation des gènes du
métabolisme du citrate citIcitMCDEFGRP sur un plasmide de 22 kb. Le gène citP est
immédiatement précédé par une (ORF) nommé CitR,
En ce qui concerne citO, il semblerait que Leuconostoc mesenteroides subsp. cremoris 195
soit la seule bactérie lactique où ce gène est identifié parmi les gènes du métabolisme du
citrate (entre citG et citP). Cependant, chez Weissella paramesenteroides au même
emplacement (entre citG et citP) on trouve un gène nommé citR qui code pour une protéine
citR dont l’extrémité C-terminale est extrêmement semblable (97%) au CitR de Lactococcus
lactis subsp. lactis biovar diacetylactis; mais son extremité N-terminale est homologue aux
estérases et peroxydases (Martin et al., 2005).
Chez le genre Lactococcus, l’examen de la région chromosomique en aval de citG chez
Lactococcus lactis subsp. lactis biovar diacetylactis et la région plasmidique en amont de citP
chez la même souche, révèle la présence de séquences d’insertion ou d’un phage intégré. Le
gène citP est précédé de deux ORFs citQ et citR (Lopez de Felipe et al., 1996) (Fig. 31). Des
identités de 44% ont été observées entre les acides aminés de citR et l’extrémité C-terminale
de citO de Leuconostoc mesenteroides subsp. cremoris 195. Notre étude suggère que citQR ne
83
sont que des vestiges du gène citO (codant pour une lipase/estérase présumé) et pourrait
correspondre à un gène de citO inactivé par l’intégration de la séquence d’insertion IS982.
L’analyse transcriptionelle des gènes du métabolisme du citrate chez Leuconostoc
mesenteroides subsp. cremoris 195 montre que deux transcrits de 5,2 kb mae, citCDEF et 4
kb citGOP, ont été détectées seulement quand des cellules ont été cultivés en présence du
citrate. Le deuxième transcrit de 4 kb pourrait être le résultat d'une hydrolyse du grand
transcrit ou un ARN messager synthétiser de novo.
Chez Weissella paramesenteroides un transcrit polycistronique de 8,8 kb est détecté par
northern blot en présence de citrate (Martin et al, 1999, 2000).
Chez Lactococcus lactis subsp. lactis biovar. diacetylactis une forte utilisation du citrate a
été observée à pH acide 4,5 (Magni et al.,1999).
Discussion du rôle de citO dans le métabolisme du citrate chez Leuconostoc
mesenteroides subsp. cremoris 195.
Les travaux ont permis de découvrir une phase ouverte de lecture désigné citO localisé en
aval du locus citrate lyase. L’interrogation des banques protéiques, a montré une similarité de
la protéine CitO avec les lipases/estérases. La localisation de citO entre les gènes du transport
et du clivage du citrate, suggère un rôle pour CitO dans le métabolisme de l’acide citrique.
Et pour mieux discuter le rôle de CitO il faut comprendre la structure et la modulation
biochimique de la citrate lyase ainsi que le rôle de CitG dans la synthèse de la citrate lyase.
La citrate lyase native de Leuconostoc mesenteroides subsp. cremoris 195 est sous forme
d’un complexe multiprotéique  (55 kDa),  (33 kDa) et  (10 kDa) (Bekal et al., 1998).
La sous unité  est l’activité acyl-transférase (EC 2.8.3.10) ; la sous unité  catalyse
l’activité citryl-S-ACP lyase (EC 4.1.3.34) et la sous unité  est l’Acyl carrier protein (ACP).
L’ACP porte un groupement prosthétique dont l’acétylation conduit à l’activation du
complexe citrate lyase. Bott et Dimroth, (1994) en mis en évidence le fonctionnement de la
citrate lyase chez Klebsiella pneumoniae. Le clivage du citrate par la citrate lyase s’effectue
en deux étapes principales. La première consiste en un échange du groupement acétyl de
l’ACP par un groupement citryl catalysé par la sous unité . Après activation du substrat
(citrate), la seconde étape catalysée par la sous unité , complète le cycle par hydrolyse du
groupement citryl en libérant de l’oxaloacétate et régénérant ainsi de l’acétyl-ACP (Fig. 6).
La citrate lyase n’est activé que si le groupement prosthétique de l’ACP est acétylé.
L’activation in vivo de la citrate lyase est réalisée par la citrate lyase ligase, qui en présence
d’ATP et d’acétate, catalyse l’acétylation du groupement prosthétique.
84
En absence de citrate
Présence de citrate
O
CitG
CL Ser
+
R
-S-H
CL Ser
1
P
O
S-H
R
O
Citrate lyase néoformée
(inactive)
Citrate lyase inactive
(acétylable)
Groupement prosthétique
(non acétylé)
+
Présence de citrate
*
Groupement acétyle
Citrate lyase ligase
(CitC)
O
Citrate lyase active
(acétylée)
CL Ser
P
O
R
S
O
2
*
Absence de citrate
3
Citrate lyase désacétylase
CitO ?
CL Ser
+
R
S
*
Citrate lyase inactive
(non acétylable)
Figure 32 : Schéma représentant l'hypothèse du rôle de CitO dans l’activité citrate lyase.
1 : CitG synthèse et fixation du groupement prosthétique à l'ACP de la citrate lyase (scheinder et al., 2000).
2 : Acétylation du groupement prosthétique par la citrate lyase ligase (Dimroth, 1976)
3 : Inactivation de la citrate lyase par détachement du groupement prosthétique (Résultats non publiés).
CL, citrate lyase ; R, groupement prosthétique.
85
En ce qui concerne CitG, chez tous les micro-organismes étudiés et capables d’utiliser le
citrate, le gène citG est associé aux gène de la citrate lyase (citDEF). Chez Klebsiella
pneumoniae, ce gène est transcrit avec les gènes citCDEF (Bott et al., 1995) alors que chez
Leuconostoc mesenteroides subsp. cremoris 195 citG est transcrit avec les gènes citGOP
localisés en aval du locus citrate lyase (Krantar et al., 2006). Schneider et al., (2000) ont mis
en évidence le rôle de citG chez Klebsiella pneumoniae. CitG est responsable de la
biosynthèse du groupement prosthétique de la sous unité  (Acyl Carrier Protein) de la citrate
lyase.
Bien que nous n’excluions aucune proposition pour la fonction de cette protéine, nous
pouvons tout de même discuter son rôle présumé dans la modulation de l’activité de la citrate
lyase. Deux liaisons esters jouent un rôle important dans l’activité citrate lyase :
Le groupement prosthétique est attaché au résidu serine de l’acyl carrier protein de la
citrate lyase par un pont phosphodiester ; si CitO est capable d'hydrolyser cette liaison, il peut
en résulter une citrate lyase inactive non acétylable, puisque elle perdrait son groupement
prosthétique (Fig. 32).
86
CONCLUSION
La génétique des Leuconostocs est mal connue jusqu’aujourd’hui. Alors qu’on connait le
génome complet de Lactococcus lactis IL1403 depuis 2001, le séquençage complet du
génome de Leuconostoc mesenteroides (2,1 Mb) n’est qu’en phase d’assemblage des contigs
(dans un laboratoire de l’université de californie) (www.img.jgi.gov).
Ce travail contribue à l’enrichissement des connaissances fondamentales sur la génétique
du métabolisme du citrate chez les Leuconostocs.
Notre souche Leuconostoc mesenteroides subsp. cremoris 195 se révèle un modèle original
dans l'organisation des gènes impliqués dans le métabolisme du citrate. Sur le même fragment
d’ADN chromosomique, sont rassemblés les gènes impliqués dans l’activité citrate lyase
citCDEFG, un gène de transport CitP, un gène de régulation clyR ainsi que d’autres gènes
(mae: enzyme malique, citO: lipases/estérases) dont le rôle dans le métabolisme du citrate
reste à confirmé. Cette souche se distingue aussi par rapport à Leuconostoc mesentéroides
subsp. mesenteroides par l’influence positive du pH acide sur l’entrée du citrate qui se traduit
par l’augmentation de la vitesse de consommation du citrate en milieux acides et en présence
de glucose.
Les résultats obtenus ouvrent de nouvelles perspectives de recherche notamment au niveau
de la régulation post transcriptionnelle (rôle présumé de citO).
PERSPECTIVES
La fonction de CitO n'étant pas encore établie, son rôle dans le métabolisme du citrate peut
être discuté. Chez Leuconostoc mesenteroides subsp. cremoris la citrate lyase inactive ne peut
être réactivée par acétylation. Nous savons aussi que le groupement prosthétique de la citrate
lyase est attaché au résidu serine de l'acyl carrier protein par une liaison phosphodiester. Si
CitO est capable d'hydrolyser cette liaison, il peut en résulter une citrate lyase inactive non
acétylable, puisque elle perdrait son groupement prosthétique.
Pour vérifier notre hypothèse on a envisagé à court terme les expériences suivantes:
 Purifier la protéine CitO grâce à un système d'expression purification Hist-tag, l'ajouter
à l'extrait brut de Leuconostoc mesenteroides subsp. cremoris cultivée en présence et absence
du citrate et doser l'activité de la citrate lyase.
 A défaut d'avoir un mutant citO- chez Leuconostoc mesenteroides subsp. cremoris
(absence d'outils génétique performants chez cette souche). Nous étudierons le rôle de CitO
chez une souche de Lactococcus IL1403.
87
REFFERENCES BIBLIOGRAPHIQUES
1. Antranikian, G and Gottschalk, G. (1989). Phosphorylation of citrate lyase ligase in Clostridium
sphenoides and regulation of anaerobic citrate metabolism in other bacteria. Biochem. 71: 1029-1037.
2. Bandell, M., Lhotte, M.E., Marty-Teysset, C., Veyrat, A., Prévost, H., Dartois, V., Diviès, C.,
Konings, N.W and Lolkema, J.S. (1998). Mechanism of the citrate transporters in carbohydrate and
citrate co-metabolism in Lactococcus and Leuconostoc species. J. Appl. Environ. Microbiol. 64: 15941600.
3. Bekal, S., Van Beeumen, J., Samyn, B., Garmyn, D., Henini, S., Diviès, C and Prévost, H.
(1998). Purification of Leuconostoc mesenteroïdes citrate lyase and cloning and characterization of cit
CDEFG gene cluster. J. Bacteriol. 180: 647-654.
4. Bekal-Si-Ali, S., Diviès, C. and Prévost, H. (1999). Genetic organization of the citCDEF locus and
identification of mae and clyR genes from Leuconostoc mesenteroides. J. Bacteriol. 181: 4411-4416.
5. Belguendouz, T., Cahon, R and Diviès, C. (1996). Kinetics of citrate uptake in growing cells of
Leuconostoc ssp. FEMS Microbiol. Lett. 139 : 239-244.
6. Bensing, B.A., Meyer, B.J and Dunny, G.M. (1996). Sensitive detection of bacterial transcription
initiation sites and differentiation from RNA processing sites in the pheromone-induced plasmid
transfer system of Enterococcus faecalis. Proc. Natl. Acad. Sci. USA. 93: 7794-7799.
7. Bergsma, J and Konings, W.N. (1983). The properties of citrate transport in membrane vesicles
from Bacillus subtilis. Eur. J. Biochem. 134: 151-156.
8. Beyreuther, K., Böhmer, H and Dimroth, P. (1978). Amino-acid senquence of citrate lyase acylcarrier proteins from Klebsiella aerogenes. Eur. J. Biochem. 87: 101- 110.
9. Blair, M.D.J., Datta, S.P and Tate, S.S. (1967). Reversible inactivation of citrate lyase: effect of
metal ions and adenine nucleotides. Eur. J. Biochem. I: 26-28.
10. Blattner, F. R., Plunkett III, G., Bloch, C.A., Perla, N.T., Burland, V., Riley, M., Colladovides, J., Glasner, J.D., Rode, C.K., Mayhew, G.F., Gregor, J., Davis, N.W., Kirkpatrick, H.A.,
Goeden, M.A., Rose, D.I., Mau, B and Shao, Y. (1997). The complete genome sequence of
Escherichia coli K-12. Science. 277:1453-1474.
11. Bolotin, A., Wincker, P., Mauger, S., Jaillon, O., Malarme, K., Weissenbach, J., Ehrlich, S.D.
and Sorokin, A. (2001). The complete genome sequence of the lactic acid bacterium Lactococcus
lactis ssp. lactis IL1403. Genome Res. 11: 731-753.
12. Boorsma, A., Vanderrest, M.E., Lolkema, J.S and Konings, W.N. (1996). Secondary
transporters for citrate and the Mg2+-citrate complex in Bacillus subtilis are homologous proteins. J.
Bacteriol. 178:62 16-6222.
13. Bott, M. (1997). Anaerobic citrate metabolism and its regulation in enterobacteria. Arch
Microbiol. 167: 78-88.
14. Bott, M., Meyer, M and Dimroth, P. (1995). Regulation of anaerobic citrate metabolism in
Klebsiella pneumoniae. Mol. Microbiol. 18: 533-546.
15. Bott, M and Dimroth, P. (1994). Klebsiella pneumoniae genes for citrate lyase and citrate lyase
ligase: localisation, sequencing, and expression. Mol. Microbiol. 14: 347-356.
88
16. Bottazzi, V. (1988). An introduction to rod-sharped lactic acid bacteria. Biochimie. 7: 303-315.
17. Bourel, G., Bekal, S., Diviès, C and Prévost, H. (1996). Citrate permease gene expression in
Lactococcus lactis subsp. lactis strains IL1403 and MG1363. FEMS Microbiol. Lett. 145 : 367-370.
18. Bourgeois, C.M and Leveau, J.Y. (1991). Techniques d’analyses et de contrôle dans les
industries agroalimentaires. 2 ème ed, Lavoisier - Tech et Doc : 153-202.
19. Brewer, C.R and Werkman, C.H. (1939). The anaerobic dissimilation of citric acid by
Aerobacter indologenes. Enzymologia 6: 273-281.
20. Brown, M.C and Collins, E.B. (1977). End products and fermentation balances for lactic
streptococci grown aerobically on low concentration of glucose. Appl. Environ. Microbiol. 33: 38-42.
21. Chekroun, A., Bensoltane, A., Kheroua, O and Saidi, D. (2006). Biotechnological
characteristics of fermented milk by bacterial associations of the strains Streptococcus, Lactobacillus
and Bifidobacteria. Egypt. J. App. Sci. 21 : (2B), 583-598.
22. Cheriguene, A., Chougrani, F and Bensoltane, A. (2006). Identification and characterization of
lactic acid bacteria isolated from Algerian goat’s milk. Pakistan journal of biological sciences 9 : (7),
1242-1249.
23. Chougrani, F., Cheriguene, A and Bensoltane, A. (2006). Identification and some technological
properties of lactic acid bacteria isolated from Algerian ewe’s milk. Egypt. J. App. Sci. 21 : (8), 148157.
24. Cogan, T.M. (1981). Constitutive nature of the enzyme of citrate metabolism in streptococcus
lactis subsp diacetylactis. J .Dairy Res. 48: 480-493.
25. Cogan, T.M. (1987). Co-metabolism of citrate and glucose by Leuconostoc ssp. Effects on growth
substrates and products. J. Appl. Bacteriol.63: 551-558.
26. Cogan, T.M and Daly, C. (1987). Cheese starter cultures. In: Cheese: Chemistry, Physics and
Microbiology (P.F. Fox, Ed.), pp. 179-249. Elsevier Applied Science, London.
27. Cogan, T.M., Fitzgerald, R.J and Doonan S. (1984). Acetolactate synthase of Leuconostoc lactis
and its regulation of acetoin production. J .Dairy Res. 51: 597-604.
28. Corpet, F. (1988). Multiple sentence alignment with hierarchical clustering. Nucl. Acids Res. 16:
10881-10890.
29. Crow, V.L. (1990). Properties of 2,3-butanediol dehydrogenases from Lactococcus lactis subsp.
lactis in Relation to citrate fermentation. Appl. Environ. Microbiol. 56: 1656-1665.
30. Daeschel, M.A., Andersson, R.E and Fleming, H.P. (1987). Microbial ecology of fermenting
plant materials. FEMS Microbiol. Rev. 46 : 357–367
31. Dagley, S and Dawes, E.A. (1953). Dissimilation of citric acid by bacterial extracts. Nature. 172:
345-346.
32. Dagley, S and Dawes, E.A. (1955). Citridesmolase: its properties and mode of action. Biochem.
Biophys. Acta. 17: 177-184.
33. Damelin, L.H., Dykes, A and von Holy, A. (1995). Biodiversity of lactic acid bacteria from foodrelated ecosystems. Microbios 83: 13–22.
89
34. David, S., Van der Rest, M.E., Driessen, A.J.M., Simons, G and de Vos, W.M. (1990).
Nucleotide sequence and expression in Escherichia coli of the Lactococcus lactis citrate permease
gene. J. Bacteriol. 172: 5789-5794.
35. Deffner, M.I and Franke, W. (1939). Der Abau der Citronsäure durch Bakterien. Ann. Chem.,
Justus Liebigs 541: 85-117.
36. De Man, J.C., Rogosa, M and Sharpe, M.E. (1960). A medium for the cultivation of
Lactobacilli. J. Bacteriol. 23 :130-135.
37. De Roissart, H and Luquet, F.M. (1991). Bactéries Lactiques. Uriage, France: Lorica.
38. De Roissart, H.B. (1986). Bactéries lactiques. I.N.R.A. Station de recherche laitière. Clermont
Ferrand France.
39. Desmazeaud, M.J and De Roissart, H. (1994). Métabolisme général des bactéries lactiques. p.
169-207, Bactéries Lactiques, vol. 23. H. De Roissart et F.M. Luquet, Lorica.
40. Desmazeaud, M.J. (1992). L’état des connaissances en matière de nutrition des bactéries
lactiques. Le lait . 63: 267-316.
41. Devoyod, J.J and Poullain, F. (1988). Les Leuconostocs Propriétés : leur rôle en technologie
laitière. Le Lait.68 : (3), 249-280.
42. Devoyod, J.J., Melcion, D and Auclair, J. (1974). Standards of selection of Leuconostoc strains
used in making of Roquefort cheese. 19th Dairy congr. New Delhi, vol. 1E, 419.
43. Di Berardino, M., Hermann, R and Dimroth, P. (1996). Cellular localization by
immunolabelling and transmission electron microscopy of oxaloacetate decarboxylase or its individual
subunits synthesized in Escherichia coli. FEMS Microbiol. Lett. 136: 31-37.
44. Di Berardino, M and Dimroth, P. (1995). Synthesis of oxaloacetate decarboxylase Na+ pump and
its individual subunits in Escherichia coli and analysis of their fonction. Eur. J. Biochem. 231: 790801.
45. Di Berardino, M and Dimroth, P. (1996). Asparate 203 of the oxaloacetate decarboxylase subunit catalyses both the chemical and vectorial reaction of the Na+ pump. EMBO. 15: 1842-l849.
46. Dicks, L.M.T., Dellaglio, F and Collins, M.D. (1995). Proposal to reclassify Leuconostoc oenos
as Oenococcus oeni [corrig.] gen. nov., comb. nov. Int.J.Syst. Bacteriol. 45: 395-397.
47. Dimroth, P. (1976). The prosthetic group of citrate-lyase acyl-carrier protein. Eur. J. Biochem. 64:
269-281.
48. Dimroth, P. (1981). Characterization of a membrane-bound biotin containing enzyme: oxalate
decarboxylase from Klebsiella aerogenes. Eur. J. Biochem. 115: 353-358.
49. Dimroth, P. (1982 a). The generation of an electrochemical gradient of sodium ions up on
decarboxylation of oxaloacetate by the membrane-bound and Na+-actived oxaloacetate decarboxylase
from Klebsiella aerogenes. Eur. J. Biochem. 121: 443-449.
50. Dimroth, P. (1982 b). The role of biotin and sodium in the decarboxylation of oxaloacetate by the
membrane-bound oxaloacetate decarboxylase from Klebsiella aerogenes. Eur. J. Biochem. 121: 43544l.
90
51. Dimroth, P. (l987). Sodium ion decarboxylases and other aspects of sodium ion cycling in
bacteria. Microbiol. Rev. 51: 320-340.
52. Dimroth, P. (1994). Bacterial sodium ion-coupled energetics. Antonie Van Leeuwenhoek. 65: 381395
53. Dimroth, P and Thomer, A. (1983). Subunit composition of oxaloacetate decarboxylase and
characterization of the  chain as carboxyltransferase. Eur. J. Biochem. 137: 107-112.
54. Dimroth, P and Thomer, A. (1986). Citrate transport in Klebsiella pneumoniae. Biol. Chem. 367:
813-823.
55. Dimroth, P and Thomer, A. (1990). Solubilisation and reconstitution of the Na+-dependent citrate
carrier of Klebsiella pneumoniae. J. Biol. Chem. 265: 7721-7724.
56. Dimroth, P and Thomer, A. (1993). On the mecanism of sodium ion translocation by
decarboxylase of Klebsiella pneumoniae. Biochemistry. 32: 1734-1739.
57. Diviès, C., Frey, L., Hubert, J.C and De Roissard, H. (1994). Métabolisme d'autres substrats
carbonés par les bactéries lactiques., p. 291-307, Bactéries lactiques, vol. I. De Roissard H. et Luquet
F.M., Lorica.
58. Drider, D., Bekal, S and Prevost, H. (2004). Genetic organisation and expression of citrate
permease in lactic acid bacteria. Genet.Mol.Res. 3 (2): 273-281.
59. Drider, D., Santos, J.M., Arraiano, C.M and Lopez, P. (1998). RNA processing is involved in
the post-transcriptional control of the citQRP operon from Lactococcus lactis biovar diacetylactis.
Mol. Gen. Genet. 258: 9-15.
60. Elagöz, A., Abdi, A., Hubert, J.C. and Krammerer, B. (1996). Structure and organisation of
pyrimidine biosynthesis pathway genes in Lactobacillus plantarum: a PCR strategy for sequencing
without cloning. Gene. 182: 37-43.
61. Esenthal, R., Tate, S.S and Datta, S.P. (1966). Inactivation of citrate lyase by oxaloacetate and its
structural analogues. Biochim Biophys acte. 128: 155-164.
62. Evans, A. (1918). A study of the streptococci conserved in cheese repening. J. Agr. Res. 13 : 235275.
63. Farrow, J.A.E. and Collins, M.D. (1984). DNA base composition, DNA-DNA homology and
long chain fatty acid studies on Streptococcus thermophilus and Streptococcus salivarius. J . Gen.
Microbiol. 130: 357-362.
64. Fleischmann, R.D., Adams, M.D., White, O., Clayton, R.A., Kirkness, E.F., Kerlavage, A.R.,
Bult, C.J., Tomb, J.F., Dougherty, B.A., Merrick, J.M., Mckenney, K., Sutton, G., Fitzhugh, W.,
Fields, C.A., Gocayne, J.D., Scott, J.D., Shirley, R., Liul, I., Glodek, A., Kelley, J.M., Weidman,
J.F., Phillips, C.A., Spriggs, T., Hedblome, E., Cotton, M.D., Utterback, T.R., Hanna, M.C.,
Nguyen, D.T., Saudek, D.M., Brandon, R.C., Fine, L.D., Fritchman, J.L., Fuhrmann, J.L.,
Geoghagen, N.S.M., Gnehm, C.L., McDonald, L.A., Small, K.V., Fraser, C.M, Smith, H.O and
Venter, J.C. (1995). Whole-genome random sequencing and assembly of Haemophilus influenzae.
Rd.Science. 269: 496-512.
65. Garcia-Quintans, N., Magni, C., de Mendoza, D and López, P. (1998). The citrate transport
system of Lactococcus lactis subsp. lactis biovar diacetylactis is induced by acid stress. Appl. Environ.
Microbiol. 64: 850-857.
91
66. Garmyn, D., Monnet, C., Martineau, B., Cavin, J.F and Diviès, C. (1996). Cloning and
sequencing of the gene encoding alpha-acetolactate decarboxylase from Leuconostoc oenos. FEMS
Microbiol. Lett. 145: 445-450.
67. Garvie, E.I. (1986). Gram positive cocci genus Leuconostoc in bergeys manual of systematic
bacteriology , Vol 2,9 th Ed. Williams and Wilkins Co baltimore : 1071-1075.
68. Garvie, E.I. (1984). Separation of genus Leuconostoc and differentiation of the leuconostocs from
other lactic acid bacteria. In Methods in microbiology Volume 16. Academic press London : 147-178.
69. Gibson, T.D., Parker, S.M and Woodward, J.R. (1991). Purification and characterization of
diacetyl reductase from chiken liver and Streptococcus lactis and enzyme determination of diacetyl
and diketones. Enzymes Microb. Technol. 13: 171-179.
70. Guiraud, J and Galzy, P. (1980). L’analyse microbiologiste dans les industries Alimentaires.
L’usine Noveli Paris : 130-152.
71. Hadadji, M and Bensoltane, A. (2006). Growth and lactic acid production by Bifidobacterium
longum and Lactobacillus acidophilus in goat’s milk. AJB Vol. 5: (6), 505-509.
72. Harvey, R.J and Collins, E.B. (1962). Citrate transport system of Streptococcus diacetylactis. J.
Bacteriol. 83: 1005-1009.
73. Harvey, R. J and Collins, E.B. (1961). Role of citratase in acetoin formation by Streptococcus
diacelylactis and Leuconostoc citrovorum. J. Bacteriol. 82: 954-959.
74. Himmelreich, R., Hilbert, H., Plaagens, H., Pirltl, E., Li, B.C. and Herrmann. R. (1996).
Complete senquence analysis of the genome of the bacterium Mycoplasm pneumoniae. Nucleic Acids
Res. 24: 4420-4449.
75. Holzapfel, W.H and Schillinger U. (1992). The genus Leuconostoc. In: Balows A, Trüper HG,
Dworkin M, Harder W and Schleifer KH (eds) The Procaryotes, 2nd edn. Vol. II, p. 1508. New York:
Springer Verlag.
76. Hoop, T. P and Woods, K. R. (1981). Prediction of protein antigenic determination from amino
acid sequence. Porc. Natl. Acad. Sci. USA. 78 : 3824-3828.
77. Hugenholtz, J. (1993). Citrate metabolism in acid lactic bacteria. FEMS Microbiol. Rev. 12: 165178.
78. Hugenholtz, J and Starrenburg, M.J.C. (1992). Diacetyl production by differents strains of
Streptococcus lactis subsp. diacetylactis and Leuconostoc ssp. Appl. Microbiol. Biotechnol. 38: 1722.
79. Hugenholtz, J., Perdon, L and Abee, T. (1993). Growth and Energy Genaration by Lactococcus
lactis subsp. lactis biovar. diacetylactis during Citrate metabolism. Appl. Environ. Microbiol. 59:
4216-4222.
80. Ishiguro, N., Izawa, H., Shinagawa, M., Shimamoto, T and Tsuchiya, T. (1992). Cloning and
nucleotid senquence of the gene (CitC) encoding a citrate carrier from several Salmonella sarovars. J.
Biol. Chem. 267: 9559-9564.
81. Ishiguro, N., Oka, C and Sato, G. (1978). Isolation of citrate-positive variants of Escherichia coli
from domestic pigeons, pigs, cattle, and horses. Appl. Environ. Microbiol. 36: 217-222.
92
82. Johnson, C.L., Cha, Y. A and Stern, J.R. (1975). Citrate uptake in membrane vesicles of
Klebsiella aerogenes. J. Bacteriol. 121: 682-687.
83. Juillard, V., Spinnler, H.E., Desmazeaud, M.J and Boquien, C.Y. (1987). Phénomènes de
coopération et d'inhibition entre les bactéries tactiques utilisées en industrie laitière. Lait. 67: 149-172.
84. Kempler, G.M and Mc Kay, L.L. (1981). Biochemistry and genetics of citrate utilisation by
Streptococcus lactis subsp. diacetylactis. J. Dairy Sci. 64: 1527-1530.
85. Kempler, G.M and Mc Kay, L.L. (1980). Improvedmedium for detection of citrate fermenting
streptococcus lactis subsp diacetylactis. Appl. Environ. Microbiol. 39: 926-927.
86. Kihal, M., Prevost, H., Lhotte, M.E., Huang, D.Q and Diviès, C. (1996). Instability of plasmidencoded citrate permease in Leuconostoc. Lett. Appl. Microbiol. 22: 219-223.
87. Konings, W.N., Poolman, B and Driessen, A.J.M. (1989). Bioenergetics and solute transport in
lactococci. CRC Crit. Rev. Microbiol. 16: 419-476.
88. Krantar, K., Bekal, S., Drider, D., Prevost, H and Bensoltane, A. (2006). Characterization of
the first chromosomal citrate permease gene of Leuconostoc mesenteroides subsp. cremoris 195 in
lactic acid bacteria. Egypt. J. App. Sci. 21 : (3), 133-150.
89. Kröger, A. (1974). Electron-transport phosphorylation coupled to fumarate reduction in
anaerobically grown Proteus rettgeri. Biochim. Biophys. Acta. 347: 273-289.
90. Larpent, J.P., Larpent, M and Tgourga, O.D. (1990). Mémento technique de microbiologie 2ème
Ed . Tech et Doc . Lavoisier.
91. Levata-Jovanovic, M and Sandine, W.E. (1996). Citrate utilisation and diacetyl production by
various strains of Leuconostoc mesenteroides ssp. cremoris. J. Dairy Sci.79 : 1928-1935.
92. Leveau, J.Y., Bouix M and De Roissart, H. (1991). La flore lactique (chapitre3) technique
d’analyse et de contrôle dans les industries agroalimentaires. 3 Ed . Tech et Doc Lavoisier. Paris.
93. Lhotte, M.E., Guzzo, J., Dartois, V., Prévost, H and Diviès, C. (1995). Nucleotide sequence of
the citP gene of Leuconostoc mesenteroides subsp. mesenteroides strain 19D, Genbank accession
number: L29572.
94. Lin, J., Schmitt, P and Diviès, C. (1991). Characterization of a citrate-negative mutant of
Leuconostoc mesenteroides: metabolic and plasmidic properties. Appl. Microbiol. Biotechnol. 34: 628631.
95. Lolkema, J.S., Enequist, H and Van Der Rest, M.E. (1994). Transport of citrate catalysed by the
sodium-dependent citrate carrier of Klebsiella pneumoniae is obligatory coupled to the transport of
two sodium ions. Eur. J. Biochem. 220: 469-475.
96. Lonvaud-Funel, A. (1999). Leuconostoc. Faculty of Œnology, University Victor Segalen,
Bordeaux, France. Academic Press.
97. López de Felipe, F., Magni, C., de Mendoza, D and López, P. (1995). Citrate utilization gene
cluster of the Lactococcus lactis biovar diacetylactis: organization and regulation of expression. Mol.
Gen. Genet. 246: 590-599.
98. Lütgens, M and Gottschalk, G. (1980). Why a Co-substrate is Required for anaerobic Growth of
Escherichia coli on Citrate. Journal of General Microbiology. 119: 63-70.
93
99. Magni, C., de Mendoza, D., Konings, W.N and Lolkema, J.S. (1999). Mechanism of Citrate
Metabolism in Lactococcus lactis Resistance against Lactate Toxicity at Low pH. J. Bacteriol. 181,
No.5: 1451-1457.
100. Magni, C., Lopez de Felipe, F., Sesma, F., Lopez, P and De Mendoza, D. (1994). Citrate
transport in Lactococcus lactis biovar. diacetylactis : expression of the plasmid-borne citrate permease
P. FEMS Microbiol. Lett.118: 75-82.
101. Mahi, M., Yagoubi, A., Rouissat, L., Tabak, S., Medouakh, L and Bensoltane, A. (2006)
Growth, viability and acidifying activity of bifidobacteria in goat’s milk. Egypt. J. App. Sci. 21 : (3),
248-261
102. Martin, M., Corrales, M.A., de Mendoza, D., López, P and Magni, C. (1999). Cloning and
molecular characterization of the citrate utilization citMCDEFGRP cluster of Leuconostoc
paramesenteroides. FEMS Microbiol. Lett. 174: 231-238.
103. Martin, M., Magni, C., López, P and de Mendoza, D. (2000). Transcriptional control of the
citrate-inducible citMCDEFGRP operon encoding genes involved in citrate fermentation in
Leuconostoc paramesenteroides. J. Bacteriol. 182: 3904-3912.
104. Martin, M., Magni, C., de Mendoza, D and Paloma L. (2005). CitI, a transcription factor
involved in regulation of citrate metabolism in lactic acid bacteria. J. Bacteriol. 187: 5146-5155
105. Marty-Teysset, C., Lolkema, J.S., Schmitt, P., Diviès, C and Konings, W.N. (1995).
Membrane potentialgenerating transport of citrate and malate catalyzed by CitP of Leuconostoc
mesenteroides. J. Biol.Chem. 270: 25370-25376.
106. Marty-Teysset, C., Lolkema, J.S., Schmitt, P., Diviès, C and Konings, W.N. (1996). The
citrate metabolic pathway in Leuconostoc mesenteroides: expression, amino acid synthesis, and
ketocarboxylate transport. J. Bacteriol. 178: 6209-6215.
107. Marty-Teysset, C., Posthuma, C., Lolkema, J.S., Schmitt, P., Diviès, C and Konings, W.N.
(1996). Proton motive force generation by citrolactic fermentation in Leuconostoc mesenteroides.
J.Bacteriol. 178: 2178-2185.
108. Mathot, A.G., Kihal, M., Prevost, H. and Divies, C. (1994). Selective Enumeration of
Leuconostoc on Vancomycin Agar Media. Int. Dairy. J. 4 : 459-469.
109. Mellerick, D and Cogan, T.M. (1981). Induction of some enzymes of citrate metabolism in
Leuconostoc lactis and other heterofennentative lactic acid bacteria. J.Dairy Res. 48: 497-502.
110. Meyer, M., Dimroth, P and Bott, M. (1997). In Vitro Binding of the Response Regulator CitB
and of its Carboxy-terminal Domain to A + T-rich DNA Target Sequences in the control Region of the
Divergent citC and citS Operons of the Klebsiella pneumoniae. J. Mol. Biol. 269: 719-731.
111. Monnet, C., Schmitt, P and Diviès, C. (1994). Diacetyl production in milk by an acetolactic acid
accumulating strain of Lactococcus lactis ssp lactis biovar diacetylactis. J.Dairy Sci. 77: 2916-2924.
112. Novel, G. (1993). Les bactéries lactiques. In : microbiologie industrielle, les microorganismes
d’intérêt industriel. Ed. Lavoisier Doc et Tech. Paris : 170-330.
113. O'Brien, R.W and Stern, J.R. (1969). Requirement for sodium in the anaerobic growth of
aerobacter aerogenes on citrate. J. bacteriol. 98: 388-393.
94
114. Oppenheimer, J.N., Singh, M., Sweely, C.C., Sung, S.J and Srere, P.A. (1979). The
configuration and location of the ribosidic linkage in the prosthetic group of citrate lyase (Klebsiella
aerogenes). J. Biol. Chem. 254: l000-1002.
115. Orla, J. (1919). The lactic acid bacteria. Rey, Sci . Lett, Copenhagenseet. Sci. 5 : 81-196.
116. Petransxiene, D and Lapied, L. (1981). Qualité bactériologique du lait et des produits laitières, 2
ème Ed Lavoisier Doc et Tech . : 135-204.
117. Phalip, V., Monnet, C., Renault, P., Godon, J.J and Diviès C. (1994). Purification and
properties of the alpha-acetolactate decarboxylase from Lactococcus lactis subsp. lactis NCDO 21l8.
FEBS Lett. 29: 95-99.
118. Pos, K.M., Dimroth, P and Bott, M. (1998). The Escherichia coli Citrate Carrier CitT: a
Member of a Novel Eubacterial Transporter Family Related to the 2-oxoglutarate/malate Translator
from Spinach Chloroplasts. J. Bacteriol. 180, No. 16: 4160-4165.
119. Rawadi, G., Lalanne, I. L. and Roulland-Dussoix, D. (1995). Cloning and characterization of
the lipase operon from Mycoplasma mycoides subsp. mycoides LC. Gene. 158: 107-111.
120. Robinson, J.B., Singh, M and Srere, P.A. (1976). Structure of the prosthetic group of Klebsiella
aerogenes citrate (pro-3s)-lyase. Proc. Natl. Acad. Sci. USA. 73: 1872-1876.
121. Rodolphe, B., Yoon, S.S., Breidt, F., Fleming, H.P and Klaenhammer, T. (2002).
Identification and characterization of Leuconostoc fallax strains isolated from an industriel sauerkraut
fermentation. App. Env. Microbiol.68: 2877-2884.
122. Rouissat, L and Bensoltane, A. (2006). Physico-chemical, microbiological and biotechnological
studies of lactic acid flora isolated from ewe’s milk of Algerian two breeds (Ouled Djellal and El
Hamra). Egypt. J. App. Sci. 21 : (2B), 567-582.
123. Sambrook, J., Fritsch, E. F and Maniatis, T. (1989). Molecular cloning. A laboratory Manual.
Cold Spring Harbor, New york : Cold Spring Harbor Laboratory Press.
124. Sandine, W E. (1988). New nomenclature of the non strapped lactic acid bacteria. Biochimie
70 : 519-522.
125. Scardovi, V. (1986). Bifidobactirium oenus (Orla, J. 1924) in bergey’s manual of systematic
bacteriology.
126. Schleiffr, K.H., Kraus,J and Dvorak, C. (1985). Transfer of Streptococcus lactis and related
Streptococcus the genus Lactococcus. Syst. Appl Microbio. 6 : 182-195.
127. Schmitt, P., Diviès, C and Meriot, C. (1990). Utilization of citrate by Leuconostoc
mesenteroides subsp. cremoris in continuous culture. Biotechnol. Lett. 12 (2): 127- 130.
128. Schmitt, P., Vasseur, C., Phalip, V., Hang, D.Q., Diviès, C and Prevost, H. (1997). Diacetyl
and acetoin production from the co-metabolism of citrate and xylose by Leuconostoc mesenteroides
subsp. mesenteroides. Appl. Environ. Microbiol. 47: 715-7 18.
129. Schmitt, P and Diviès, C. (1992). Effect of varying citrate levels on C4 compound formation and
on enzyme levels in Leuconostoc mesenteroides subsp. cremoris grown in continuous culture. Appl.
Microbiol. Biotechnol. 37: 426-430.
130. Schmitt, P and Diviès, C. (1991). Co-metabolism of citrate and lactose by Leuconostoc
mesenteroides subsp. cremoris. J. fermentation bioengineering. 71: 72-74.
95
131. Schneider, K., Dimroth, P and Bott, M. (2000). Biosyhthesis of Prosthetic Group of Citrate
Lyase. Biochemistry. 39: 9438-9450.
132. Schwarz, E and Oesterhelt, D. (1985). Cloning and expression of Klebsiella pneumoniae genes
coding for citrate transport and fermentation. EMBO. 4: 1599-1603.
133. Shaw, B.G and Harding, C.D. (1989). Leuconostoc gelidum sp. nov. and Leuconostoc carnosum
sp. nov. from chill-stored meats. Int. J.Syst. Bacteriol. 39: 217-223.
134. Shimamoto, T., Izawa, H., Daimon, H., Ishiguro, N., Shinagawa, M., Sakano, Y., Tsuda, M
and Tsuchiya, T. (1991). Cloning and nucleotide sequence of the gene (citA) encoding a citrate carrier
from Salmonella typhimurium. J. Biochem. 110: 22-28.
135. Singh, M and Srere, P. (1975). Purification and properties of citrate lyase from Streptococcus
diacetylactis. J. Biol. Chem. 250: 5818-5825.
136. Singh, M., Richards, M.E., Mukherjee, A and Srere, P.A. (1976). Structure of ATP citrate
lease from rat liver. Physicochemical studies and proteolytic modification. J. Biol. Chem. 251:52425250.
137. Singh, M., Robinson, J.B and Srere, P.A. (1977). On the structure of the prosthetic group of
citrate (pro-3S)-lyase. J. Biol. Chem. 252: 6061-6068.
138. Sinha, R. P. (1990). Effect of growth media and extented incubation on the appearance of lactose
non-fermerting variants in Lactococci. J. Food Protection.7: 583-587.
139. Starrenburg, M and Hugenholtz, J. (1991). Citrate fermentation by Lactococcus and
Leuconostoc ssp. Appl. Environ. Microbiol. 57: 3535-3540.
140. Stiles, M.E and Holzapfel, W.H. (1997). Lactic acid bacteria for foods and their current
taxonomy. Review article. Int. J. Food Microbiol. 36: 1–29.
141. Subramanian, C and Sivaraman, C. (1984). Bacterial citrate lyase. J. Biosci. 6: 379-401.
142. Terzaghi, B.E and Sandine, W.E. (1975). Improved medium for lactic streptococci and their
bacteriophages. Appl. Environ . Microbiol. 29: 807-813.
143. Van der Rest, M.E., Molenaar, D and Konings, N.W. (1992). Mechanism of Na+-dependent
citrate transport in Klebsiella pneumoniae. J. Bacteriol. 174: 4893-4898.
144. Van Der Rest, M. E., Abee, T., Molenaar, D and Konings, N.W. (1991). Mechanism and
energetics of citrate-transport system of Klebsiella pneumoniae. Eur. J. Biochem. 195: 71-77.
145. Van Der Rest, M. E., Schwarz, E., Oesterhelt, D and Konings, N.W. (1990). DNA Sequence
of a citrate carrier of Klebsiella pneumoniae. Eur. J. Biochem. 189: 401-407.
146. Van Tieghem, P. E. L. (1878). Sur la gomme de sucrerie. Ann. Sci. Nat. Bot. 6: 180-202.
147. Vaughan, E.E., David, S., Harrington, A., Daly, C., Fitzgerald, G.F and de Vos, W.N. (1995).
Characterization of plasmid-encoded citrate permease (citP) genes from Leuconostoc species reveals
high sequence conservation with the Lactococcus lactis citP gene. Appl. Environ. Microbiol. 61: 31723176.
96
148. Weber, A., Menzlaff, E., Arbinger, B., Gutensohn, M., Eckerskorn, C and Flugge, U.I.
(1995). The 2-oxaloglutarate/malate translocation chloroplast envelope membranes: molecular cloning
of a transporter containing a 12-helix motif and expression of the functional protein in yeast cells.
Biochemistry. 34: 262 1-2627.
149. Yang, D and Woese, C.R. (1989). Phylogenetic structure of the 'Leuconostocs': an interesting
case of a rapidly evolving organism. System. Appl. Microbiol. 12: 145–149.
97
SEQUENCES NUCLEIQUES
BANQUE EMBL
98
General Information
Primary Accession # AJ550521
Accession #
AJ550521
Entry Name
EMBL:LME550521
Molecule Type
genomic DNA
Sequence Length
882
Entry Division
PRO
Sequence Version
AJ550521.1
Creation Date
25-MAR-2003
Modification Date
27-MAR-2004
Description
Description
Leuconostoc mesenteroides subsp. cremoris citO gene
Keywords
citO gene. ;
Organism
Leuconostoc mesenteroides subsp. cremoris
Organism
Classification
Bacteria; Firmicutes; Lactobacillales; Leuconostoc. ;
References
1. Krantar,K.;
Submitted (18-MAR-2003) to the EMBL/GenBank/DDBJ databases. Krantar
K., Micribiology, Ensbana, 1 Esplanade Erasme, 21000 Dijon, FRANCE.
Position
1-882
2. Bekal,S.S.;
Caracterisation genetique du locus citrate lyase chez Leuconostoc
mesenteroides subsp. cremoris 195
Unpublished.
Additional Information
Features
Key
Location
source
1..882
Qualifier
Value
db_xref
taxon:33965
mol_type genomic DNA
organism Leuconostoc mesenteroides subsp.
cremoris
sub_species cremoris
strain 195
rbs
22..26
gene citO
Sequence
Characteristics
Length: 882 BP, A Count:302, C Count:137, G Count:171, T Count:272,
Others Count:0
99
Sequence
>embl|AJ550521|LME550521 Leuconostoc mesenteroides subsp. cremoris citO gene
aaccatattcttagcaagattggtgggatctttatgagtatgagctacattgtgacaaac
gatcacgtcagactcgcttacagtgatgttggagatggtccaaccatgatatttttaccg
ggctactctgatatcaaagagacgtggtattttcaatctaaatacttttccgaaaatggg
taccgtattatttgtttggactggagaagccatgggtgttcagcgcatacagccaaaaat
atgaaaatcatgcgtttagctgccgatttgcacgaactgattacaaccttaaagttagaa
aacgtcattttgattggtcattcaatgggtgctagtgtgatttgggcgtatgtgacaata
tttggacaaacgaatgttagcaaaataattacagtcgacgaatcaccaaaactaattaat
gatgtcggttggcaagcaggcatcaaaaaccttaattgggataattttattgaattggca
ccgttaattttgcagcaaccattgactgaacagcagatgccagcaacactgaaaaatgtt
cgtaatagatttaaaacagatcatccatttgatgctgatttgggatacggactactatta
gatcatatgaaacaggattggcggaaaaccgttattaacataacagttcctcaattattt
gttgtcggtgataaatcaccattatgggcaggtgattatagtaaatattgtgaaaaaaag
agcaatataaaattttttaaaactttaattaaaaatacagggcactttccgcaaatcgaa
gacgcagagcgctttaacagtgaaataaatttttttcttacaaatacttgaatgattaaa
agtatacagtctatttttttaaaaaattttaagcattatatg
100
General Information
Primary Accession # AJ550521
Accession #
AJ550521
Entry Name
EMBL:LME550521
Molecule Type
genomic DNA
Sequence Length
882
Entry Division
PRO
Sequence Version
AJ550521.1
Creation Date
25-MAR-2003
Modification Date
27-MAR-2004
Description
Description
Leuconostoc mesenteroides subsp. cremoris citO gene
Keywords
citO gene. ;
Organism
Leuconostoc mesenteroides subsp. cremoris
Organism
Classification
Bacteria; Firmicutes; Lactobacillales; Leuconostoc. ;
References
1. Krantar,K.;
Submitted (18-MAR-2003) to the EMBL/GenBank/DDBJ databases. Krantar
K., Micribiology, Ensbana, 1 Esplanade Erasme, 21000 Dijon, FRANCE.
Position
1-882
2. Bekal,S.S.;
Caracterisation genetique du locus citrate lyase chez Leuconostoc
mesenteroides subsp. cremoris 195
Unpublished.
Additional Information
Features
Key
Location
source
1..882
Qualifier
Value
db_xref
taxon:33965
mol_type genomic DNA
organism Leuconostoc mesenteroides subsp.
cremoris
sub_species cremoris
strain 195
rbs
22..26
gene citO
Sequence
Characteristics
Length: 882 BP, A Count:302, C Count:137, G Count:171, T Count:272,
Others Count:0
101
Sequence
>embl|AJ550521|LME550521 Leuconostoc mesenteroides subsp. cremoris citO gene
aaccatattcttagcaagattggtgggatctttatgagtatgagctacattgtgacaaac
gatcacgtcagactcgcttacagtgatgttggagatggtccaaccatgatatttttaccg
ggctactctgatatcaaagagacgtggtattttcaatctaaatacttttccgaaaatggg
taccgtattatttgtttggactggagaagccatgggtgttcagcgcatacagccaaaaat
atgaaaatcatgcgtttagctgccgatttgcacgaactgattacaaccttaaagttagaa
aacgtcattttgattggtcattcaatgggtgctagtgtgatttgggcgtatgtgacaata
tttggacaaacgaatgttagcaaaataattacagtcgacgaatcaccaaaactaattaat
gatgtcggttggcaagcaggcatcaaaaaccttaattgggataattttattgaattggca
ccgttaattttgcagcaaccattgactgaacagcagatgccagcaacactgaaaaatgtt
cgtaatagatttaaaacagatcatccatttgatgctgatttgggatacggactactatta
gatcatatgaaacaggattggcggaaaaccgttattaacataacagttcctcaattattt
gttgtcggtgataaatcaccattatgggcaggtgattatagtaaatattgtgaaaaaaag
agcaatataaaattttttaaaactttaattaaaaatacagggcactttccgcaaatcgaa
gacgcagagcgctttaacagtgaaataaatttttttcttacaaatacttgaatgattaaa
agtatacagtctatttttttaaaaaattttaagcattatatg
102
ANNEXES
Composition des milieux de culture (pour un litre) :
Milieu MRS (De Man, Rogosa et Sharpe, 1960)
Extrait de levure
Extrait de viande
Polypeptone
Acétate de sodium
Citrate de sodium
Glucose
KH2 PO4
MgSO4
MnSO4
Tween 80
Agar-agar
Eau distillé ( q.s.p )
pH
Autoclavage 121 ° C, 15 min
5g
10 g
10 g
5g
2g
20 g
2g
0,25g
0,05g
1 ml
15 g
1l
6,2
Milieu M17 (Terzaghi et Sandine, 1975)
Extrait de levure
Extrait de viande
Tryptone
Peptone papaïnique de soja
Peptone pepsique de viande
Acide ascorbique
Lactose
Glycérophosphate de sodium
MgSO4
Agar-agar
Eau distillée ( q.s.p )
pH
Autoclavage 121 ° C, 15 min
2,5 g
5g
2,5 g
2,5 g
5g
0,5 g
5g
19 g
0,25g
15 g
1l
7,1
Milieu de Kempler et Mc Kay (1980)
Poudre de lait écrémé
10 g
Biopolytone
2,5 g
Glucose
5g
Agar-agar
15 g
Eau distillée (q.s.p)
1l
pH
6,6 g
Le milieu est réparti à raison de 100 ml par flacon (150 ml), puis autoclavé 15 min à 121° C.
Au moment de l’emploi on rajoute :
1 ml d’une solution aqueuse de ferricyanide de potassium 10 % (p/v).
1 ml d’une solution aqueuse à 2,5 % (p/v) de citrate ferrique et citrate de sodium (p/p). Ces
solutions stérilisées par filtration (Millipores 0,22 m) sont conservées à l’obscurité à 4°C.
Pour le milieu modifié, la poudre de lait est remplacée par 3 grammes d’extrait de levure.
103
RESUME
Dans ce travail, nous avons identifiés trois gènes sur le chromosome de Leuconostoc mesenteroides
subsp. cremoris 195 en aval du locus citrate lyase (mae-citCDEFG). citO (795 pb) qui code pour une
protéine CitO (265 acides aminés) similaire aux lipases/estérase et citP (1174 pb) qui code pour une
citrate perméase (441 acides aminés) montrant une similarité de 70% avec les autres citrate perméases
lactiques, ainsi qu’une ORF qui code pour une protéine de 84 acides aminé identique à 21% aux
séquences d’insertion de la famille IS110. Le gène citP de Leuconostoc mesenteroides subsp. cremoris
195 a été cloné dans le plasmide pGID075 et introduit chez Lactococcus lactis subsp lactis biovar
diacetylactis IL 1403. L’expression a été positive. L’analyse transcriptionnelle montre l’existence de
deux transcrits, un premier transcrit de 5,2 Kb qui inclut les gènes mae citCDEF et un deuxième de 4
Kb incluant les gènes citGOP. Les deux transcrits sont détectés uniquement en présence du citrate.
Une étude de l’effet du pH et du glucose sur la consommation du citrate par des cellules non
proliférantes de Leuconostoc mesenteroides subsp. cremoris 195 a été réalisée. Les résultats obtenus
montrent qu’à pH acide (5,6) et/ou présence de glucose les cellules consomment le citrate plus vite
(2,91 h-1 à pH 6,5 et 4,26 h-1 à pH 5,6). Parmi les bactéries lactiques dont les gènes du métabolisme du
citrate sont désormais connus, Leuconostoc mesenteroides subsp. cremoris 195 se distingue par une
organisation génétique originale.
Mots clés: Leuconostoc mesenteroides subsp. cremoris, citrate, citrate permease, citrate lyase.
ABSTRACT
In this study, three genes were identified downstream of the citrate lyase cluster (mae-citCDEFG) in
Leuconostoc mesenteroides subsp. cremoris 195, citO (795 pb) encode for CitO (265 amino acid) a
protein similar to lipases/esterase, citP (1174 pb) encode for a protein (441 amino acid) showing 70 %
of similarity with other citrate permease of lactic acid bacteria and the third ORF encode 84 amino
acids which show 21% identity with IS110 family insertion sequences. The difference in amino acid
composition of CitP is mainly located at N-terminus which was found to be hydrophilic in
Leuconostoc mesenteroides subsp. cremoris 195 and hydrophobic in other lactic acid bacteria. citP of
Leuconostoc mesenteroides subsp. cremoris 195 was cloned in pGID075 and expressed in
Lactococcus lactis subsp lactis biovar diacetylactis IL1403. The gene citP of Leuconostoc
mesenteroides subsp. cremoris 195 is the first chromosomally located citrate permease gene described
in lactic acid bacteria. Two transcripts of 5.2 and 4 kb including mae citCDEF genes and citGOP
genes were identified by Northern blot. Their synthesis was induced upon addition of citrate to the
growth medium. The effect of pH and glucose on citrate metabolism was studies using resting cells.
The results shown that at pH 5.6 and in the presence of glucose, the specific rate of citrate
consumption was increased (2.91 h-1 at pH 6.5 to 4.26 h-1 at pH 5.6).
Key words: Leuconostoc mesenteroides subsp. cremoris, citrate, citrate permease, citrate lyase.
104
‫ﺗﺸﺨﯿﺺ أول ﺟﯿﻦ ﻛﺮﻣﺰ وﻣﻲ ﻣﺴﺆول ﻋﻦ ﻧﻘﻞ اﻟﺴﺘﺮات ﻋﻨﺪ ﺑﻜﺘﯿﺮات ﺣﻤﺾ اﻟﻠﺒﻦ ﻣﻦ ﻧﻮع‬
‫‪Leuconostoc mesenteroides subsp. cremoris 195‬‬
‫ﻣﻠﺨﺺ‬
‫ﻋﺮﻓﺖ ﻓﻲ ھﺬه اﻟﺪراﺳﺔ ﺛﻼﺛﺔ ﺟﯿﻨﺎت ﺗﻘﻊ ﺑﻌﺪ ﻣﺠﻤﻮﻋﺔ اﻟﺠﯿﻨﺎت‬
‫‪mae citCDEFG‬‬
‫اﻟﻤﺴﺆوﻟﺔ‬
‫ﻋﻦ ﺗﺨﻠﯿﻖ إﻧﺰﯾﻢ ﻗﻄﻊ اﻟﺴﺘﺮات ﻋﻨﺪ ﺳﻼﻟﺔ ‪Leuconostoc mesenteroides subsp. cremoris 195‬‬
‫واﻟﺘﻲ ﺗﺸﻔﺮ اﻟﺠﯿﻨﺎت اﻟﺘﺎﻟﯿﺔ‬
‫‪ ، citO‬ﺑﺮوﺗﯿﻦ )‪ 795‬زوج ﻗﺎﻋﺪي‪ -‬ﻣﻜﻮﻧﺎ ﻣﻦ ‪ 256‬ﺣﻤﺾ أﻣﯿﻨﻲ( ﺷﺒﯿﮫ‬
‫ﺑﺎﻟﻠﯿﺒﺎز‪ /‬إﺳﺘﺮا ز ‪ 1174) citP‬زوج ﻗﺎﻋﺪي – ﯾﺸﻔﺮ ﻟﺒﺮوﺗﯿﻦ ﻣﻜﻮﻧﺎ ﻣﻦ ‪ 441‬ﺣﻤﺾ أﻣﯿﻨﻲ ( ﯾﺸﺒﮫ‬
‫اﻟﺒﺮوﺗﯿﻨﺎت اﻟﻨﺎﻗﻠﺔ ﻟﻠﺴﯿﺘﺮات ﻋﻨﺪ ﺑﻜﺘﯿﺮات ﺣﻤﺾ اﻟﻠﺒﻦ )‪ . (%70‬ﯾﺸﻔﺮ اﻟﺠﯿﻦ اﻟﺜﺎﻟﺚ )‪ 84‬ﺣﻤﺾ أﻣﯿﻨﻲ‬
‫ﯾﺸﺒﮫ ‪ %21‬ﻋﺎﺋﻠﺔ اﻟﺠﯿﻨﺎت اﻟﻤﺴﺆوﻟﺔ ﻋﻦ ﻗﻄﻊ اﻟﺸﻔﺮات اﻟﻮراﺛﯿﺔ)‪.(IS110‬‬
‫إن اﻟﻔﺮق ﻓﻲ ﺗﺮﻛﯿﺒﺔ أو ﺗﺴﻠﺴﻞ اﻷﺣﻤﺎض اﻷﻣﯿﻨﯿﺔ ﻟﺒﺮوﺗﯿﻦ ‪ citP‬ﯾﻜﻤﻦ ﻓﻲ ﻧﮭﺎﯾﺔ ال ) ‪ ( N‬ﻟﺴﻠﺴﻠﺔ‬
‫اﻷﺣﻤﺎض اﻷﻣﯿﻨﯿﺔ اﻟﻤﻜﻮﻧﺔ ﻟﺬﻟﻚ اﻟﺒﺮوﺗﯿﻦ ﻓﮭﻲ ﻣﺤﺒﺔ ﻟﻠﻤﺎء ﻋﻨﺪ‬
‫‪Leuconostoc mesenteroides subsp. cremoris 195‬‬
‫و ﻛﺎرھﺔ ﻟﻠﻤﺎء ﻋﻨﺪ ﺑﻜﺘﯿﺮات ﺣﻤﺾ اﻟﻠﺒﻦ اﻟﻤﺪروﺳﺔ ‪.‬‬
‫أﺳﺘﻨﺴﺦ ﺟﯿﻦ ‪ citP‬ل ‪ Leuconostoc mesenteroides subsp. cremoris 195‬ﻋﻠﻰ اﻟﺒﻼزﻣﯿﺪ ‪pGID075‬‬
‫و ﺗﻢ إﻇﮭﺎره ﻋﻨﺪ ﺑﻜﺘﯿﺮﯾﺎ ‪Lactococcus lactis subp. lactis biovar diacetylactis IL 1403‬‬
‫و ﺗﻢ إﻇﮭﺎر زوج ﻣﻦ اﻟﺤﻤﺾ اﻟﻨﻮوي اﻟﺮﯾﺒﻮزي اﻟﺮﺳﻮل ﻃﻮﻟﮭﻤﺎ أوﻵ )‪ ( 5,2 bK‬ﯾﻀﻢ اﻟﺠﯿﻨﺎت‪mae citCDEF‬‬
‫‪ ،‬وﺛﺎﻧﯿﺎ ) ‪ ( 4 bK‬ﯾﻀﻢ اﻟﺠﯿﻨﺎ ت ‪ citGOP‬وذﻟﻚ ﻋﻨﺪﻣﺎ ﺗﻜﻮن اﻟﺒﻜﺘﯿﺮات ﻧﺎﻣﯿﺔ ﻓﻲ وﺟﻮد اﻟﺴﯿﺘﺮات‪.‬‬
‫درس أﯾﻀﺎ ﻓﻌﻞ اﻷس اﻟﮭﯿﺪﺟﯿﻨﻲ واﻟﺠﻠﻮﻛﻮز ﻋﻠﻰ إﺳﺘﻘﻼب اﻟﺴﯿﺘﺮات ﻋﻨﺪ ﺳﻼﻟﺔ ‪Lmc 195‬‬
‫ﻓﻲ ﺣﺎﻟﺔ ﺗﺜﺒﯿﻂ اﻟﺨﻼﯾﺎ اﻟﺒﻜﺘﯿﺮﯾﺔ‪ ،‬أﻇﮭﺮت اﻟﻨﺘﺎﺋﺞ ﻋﻨﺪ اﻷس اﻟﮭﯿﺪروﺟﯿﻨﻲ ‪ 5.6‬و وﺟﻮد اﻟﺠﻠﻮﻛﻮز‪ .‬أن‬
‫ﺳﺮﻋﺔ ﻧﻘﻞ اﻟﺴﯿﺘﺮات زادت ﻣﻦ ‪ 2.91 H1-‬إﻟﻰ ‪ . 4.26 H1-‬ﺗﻤﯿﺰت‬
‫‪Leuconostoc mesenteroides subsp. cremoris 195‬‬
‫ﻋﻦ ﺑﺎﻗﻲ ﺑﻜﺘﯿﺮات ﺣﻤﺾ اﻟﻠﺒﻦ اﻟﻤﺪروﺳﺔ اﻷﺧﺮى ﺑﺈﻣﺘﻼﻛﮭﺎ ﺗﺮﻛﯿﺒﺔ ﺟﯿﻨﯿﺔ ﻣﻤﯿﺰة ﻟﺠﯿﻨﺎت إﺳﺘﻘﻼب‬
‫اﻟﺴﯿﺘﺮات ﺑﺘﺴﻠﺴﻠﮭﺎ و ﻣﻮﻗﻌﮭﺎ اﻟﻜﺮوﻣﻮزوﻣﻲ‬
‫اﻟﻜﻠﻤﺎت اﻟﻤﻔﺎﺗﯿﺢ ‪ :‬ﻧﺎﻗﻞ اﻟﺴﯿﺘﺮات‪ ،‬ﻗﺎﻃﻊ اﻟﺴﯿﺘﺮات ‪،‬اﻟﺴﯿﺘﺮات‪،‬‬
‫‪Leuconostoc mesenteroides subsp. cremoris 195‬‬
‫‪105‬‬
Téléchargement
Random flashcards
Commune de paris

0 Cartes Edune

Le lapin

5 Cartes Christine Tourangeau

aaaaaaaaaaaaaaaa

4 Cartes Beniani Ilyes

Anatomie membre inf

0 Cartes Axelle Bailleau

TEST

2 Cartes Enrico Valle

Créer des cartes mémoire