MALADIE D’ALZHEIMER Namur, 19 avril 2012 ! " # $% ) . &' &( * ('% "0' 1 "'' ''' 1 2 3 4 05 + /* ,- &' 6 The early Alzheimer Gallery Alois Alzheimer, A Tübingen characteristic 1906 disease of the cerebral cortex… Frau August D. - strong feeling of jealousy towards her husband… - increasing memory impairments - hallucinations - complete apathetic end stage Dégénérescence neurofibrillaire Plaque sénile TEST DIAGNOSTIQUE : MARQUEURS BIOLOGIQUES SPECIFICITE VRAIS NEGATIFS x 100 % VRAIS NEGATIFS + FAUX POSITIFS SENSIBILITE VRAIS POSITIFS x 100% VRAIS POSITIFS + FAUX NEGATIFS TROUBLES DE LA MÉMOIRE TROUBLES DE LA MÉMOIRE TROUBLES APHASIQUES TROUBLES APHASIQUES TROUBLES PRAXIQUES TROUBLES PRAXIQUES TROUBLES PRAXIQUES L’IMAGERIE CEREBRALE 7 ) 2 ) 78 9 2 2 : 4 72 ; < ; = : => 2: ; > ? @ 2; Dégénérescence neurofibrillaire Plaque sénile CSF Aβ β 42 amyloid in AD patients 700 Statistics ANOVA + post hoc comparisons (p values) 600 500 400 300 YC / AC : ns AC / AD : < 0.0001 AC / NAD : < 0.0001 1200 AD / NAD : 0.008 1000 AD / NDD : < 0.0001 200 100 0 B-amyloïd 800 YC = young controls; AC = aged controls; Aged Controls AD = Alzheimers; NAD AD = non AD dementias; Non AD dementias NDD = non demential Non demential disorders disorders Young Controls 600 400 200 0 B-amyloïd ALZHEIMER’S DISEASE : ATROPHY OF THE BRAIN Non demented Moderate Severe Number of neurones in the cerebral cortex (109) Meynert 1868 Donaldson 1895 Thompson 1899 Berger 1921 von Economo 1926 Agduhr 1941 Shariff 1953 Haug & Rebhan 1956 Pakkenberg 1966 Haug 1985 Braendgaard et al. 1990 Regeur et al. 1994 Pakkenberg & Gundersen, 1997 0.6 1.2 9.3 5.5 14.0 5.0 6.9 16.5 2.6 13.8 13.7 18.1 F : 19 M : 23 Non compté Pôle inférieur de la cellule Di-secteur pour ‘deux sections ’ Compté Hommes Perte de 10 % au cours de la vie= 85 000 neurones /j Femmes Variance due au sexe = 21.0 % du total Variance due à l’âge = 2.4 % du total Pakkenberg & Gundersen, J Comp Neurol 1997; 384:312-320 ALZHEIMER’S DISEASE : NEURONAL LOSS 50 % in the associative cortex (Gomez-Isla et al. Ann Neurol 1997, 41:17-24) 70 % in the CA1 region of the hippocampus (West et al. Lancet 1994, 344 : 769-772) Cerveau humain : coupe transversale Cerveau humain : hippocampe Cerveau humain : hippocampe et cortex entorhinal 1. Région CA1 de l’hippocampe 1 2 2. Cortex entorhinal Cerveau humain : Noyau basal de Meynert L’Acetylcholine. L’acétylcholine est synthétisée à partir de choline et d’acetyl CoA. La réaction est catalysée par la choline acetyltransferase. L’enzyme de dégradation de l’acétylcholine est l’acetylcholinesterase. Les inhibiteurs d’acétylcholinestérase 7 ) 2 ) 78 9 2 2 : 4 72 ; < ; = : => 2: ; > ? @ 2; Dégénérescence neurofibrillaire Plaque sénile Dégénérescence neurofibrillaire Paires hélicoïdales de Filaments Composition des paires hélicoïdales de filaments Protéine tau N C 441 Marquage des dégénérescences neurofibrillaires par un anticorps antitau Tau: a microtubule associated protein (MAP) Microtubule network Without protein tau With protein tau Tau : UNE PROTEINE ASSOCIEE AUX MICROTUBULES Les protéines tau : un gène et plusieurs isoformes Le gène tau (chr 17) Protéines tau Protéines PHF-tau Les protéines tau des PHF sont hyperphosphorylées PH Fta u α-tau phosphorylé ta u u PH Fta ta u α-tau α-tau phosphorylé (Thr212) Sites de phosphorylation Altération des microtubules dans la maladie d ’Alzheimer PLAQUES SÉNILES Plaque sénile PLAQUES SÉNILES Aβ β Les plaques séniles contiennent un noyau de substance amyloïde constitué de peptide Aβ β THE AMYLOID PRECURSOR PROTEIN : APP Plasma membrane APP 695 EXTRACELLULAR INTRACELLULAR NH2 COOH DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV 10 20 30 Amyloid peptide (Aβ) 40 IA EXPRESSION OF APP IN CHO TRANSFECTED CELLS Plasma membrane APP 695 EXTRACELLULAR NH2 COOH @3H5 Western Blot c: cells m: culture medium INTRACELLULAR control @Jonas APP-transfected CHO @3H5 @3H5@Jonas α−SECRETASE CLEAVAGE OF APP α− Plasma membrane EXTRACELLULAR INTRACELLULAR NH2 COOH DAEFRHDSGYEVHHQ 10 LVFFAEDVGSNKGAIIGLMVGGVV 20 30 40 THE NON AMYLOIDOGENIC CATABOLIC PATHWAY OF APP Plasma membrane APP 695 EXTRACELLULAR NH2 INTRACELLULAR COOH α-SECRETASE Aβ ADAM 10,17 EXPRESSION OF APP IN CHO TRANSFECTED CELLS Plasma membrane APP 695 EXTRACELLULAR NH2 INTRACELLULAR COOH A B kDa 98 sαAPP 52 6 3 Aβ APP @WO2 - + - + A: Western Blot (@WO2) CHO culture medium B: Aβ β Immunoprecipitation CHO culture medium LA VOIE CATABOLIQUE AMYLOÏDOGÈNE DE L’APP APP 695 Membrane NH2 COOH β-SECRETASE sβ βAPP βCTF γ-SECRETASE Aβ β AICD LA VOIE CATABOLIQUE NON AMYLOÏDOGÈNE DE L’APP APP 695 Membrane NH2 COOH α-SECRETASE ADAM 10,17 sα αAPP αCTF γ-SECRETASE P3 AICD ! α γ β β α γ ! ! β ! 5000 4000 80 3000 98 % β =) 2% 60 1 t /2 ≅ 12 h 2000 40 sαAPP Aβ 1000 0 =) 100 t1/2 ≅ 16 h 0 12 24 36 Time (hours) 48 20 0 60 Aβ (arbitrary units) α =9 < APPs (arbitrary units) - The expression of APP does not modify the survival of CHO cells Expression of APP Ct Survival test APP sα αAPP Production of Aβ β ELISA (pg/ml) extracellular Aβ β 40 4711 ± 703 Aβ β 42 427 ± 47 intracellular non detect. Aβ β 42 non detect. Aβ β 40 150 % control Western Blot 100 50 0 ct APP Inherited Alzheimer’s diseases genes chr. APP (39) 21 mutations * PS1 (184) 14 mutations * * PS2 (23) 1 Aβ β Production Aβ β42/40 Ratio EXPRESSION OF HUMAN APP IN RAT NEURONS Expression of human APP in rat neurons is toxic Cells kDa APP Western Blot 9852- Culture medium sα αAPP Western Blot 9852- IP 9852- sα αAPP 100 ** 50 0 1963- Days % control 150 Aβ β 01 2 3 4 Ct β-gal APP Survival test Extracellular APP/Aβ β are not neurotoxic * Culture medium of neurons * Culture medium of CHO APP products from neurons Ct β-gal APP products from CHO cells Ct APP Western Blot sαAPP ELISA (pg/ml) Aβ 40 153 ± 32 Aβ 42 non detect Aβ 40 4711 ± 703 ELISA (pg/ml) Aβ 42 Survival test 50 ct β-gal APP % control % control sαAPP 427 ± 47 150 100 0 APP Western Blot 150 Survival test Survival test Treatment of control neurons 100 50 0 ct APP Neurotoxicity is induced by intraneuronal Aβ β 42 Expression of APP 3 DAYS 5 DAYS NI NI APP APP 121 APP 74 6 Aβ β 3 Intraneuronal Aβ Aβ1-42 (pg/mg) NI APP - - NI - (% control) (% control) 50 0 - 115±24 184±29 100 100 Cell survival APP ** ** ** 50 0 β-gal - + - β-gal - + - - APP - - + APP - - + - + + INHIBITION DE LA PRODUCTION D ’Aβ β APP 695 Membrane plasmique EXTRACELLULAIRE NH2 INTRACELLULAIRE COOH β-secretase (BACE) γ-secretase Inhibiteur de la γ-secretase DAPT Aβ The inhibition of γ-secretase decreases the production of intraneuronal Aβ β and increases neuronal survival Intraneuronal APP NI Extracellular APP NI APP APP DAPT APP DAPT 121 APP 121 sαAPP 74 Intraneuronal Aβ NI 74 Aβ β1-42 pg/mg NI - APP 61±2 APP DAPT - - APP APP DAPT 115 ±23 49 ±34 - 57 % Aβ β1-42int Cell survival (% control) Extracellular Aβ Aβ β1-40 (pg/ml) APP ** 100 ** *** 50 0 Ct APP APP DAPT + 52 % survival INTRANEURONAL AGGREGATION OF Aβ β 1−42 DAYS 5 Aβ β1-42 pg/mg 115 ±23 7 Intraneuronal Aβ - 17 11 6 3 OLIGOMERIZATION ACCUMULATION INTRANEURONALE D’OLIGOMERES D’Aβ β Les plaques séniles: le dépôt d’amyloïde Aß Anti- amyloïde Aß Filaments d’amyloïde Aß MODÈLES ANIMAUX : SOURIS TRANSGÉNIQUES Gène APP Protéine APP Dépôts d’amyloïde Aβ β Lesions in transgenic mice Alzheimer Transgenic mice Formation de dépôts d’Aß dans des souris transgéniques H&E Anti-Aß Aß Intracellulaire Aß Extracellulaire 2 mois 2.5 mois 4 mois 12 mois 18 mois ) " $ ! % ! # % % ! & β ' $ ! % % % ! & ! % MALADIE D’ALZHEIMER : NOUVELLES APPROCHES THÉRAPEUTIQUES APP695 Aβ agrégé Aβ fibrillaire Aβ β/γ Inhibiteurs des sécrétases Vaccination ADDLs Inhibiteurs de l’agrégation VACCINATION DES SOURIS TRANSGENIQUES Contrôles Vaccinées Schenk et al. (1999), Nature 400, 173 TESTS D’APPRENTISSAGE CHEZ LA SOURIS Arendash et al. (2001), DNA Cell Biol 20, 737 VACCIN POUR LA MALADIE D’ALZHEIMER Essai clinique du vaccin AN-1792 (2000) 360 patients. Essai clinique interrompu en janvier 2002 : Encéphalopahie méningée chez 15 patients. Examen neuropathologique post-mortem. Nicoll et al. (2003) Nature Medecine 9,448 = > - 4 *A' = > - 4 *A' () ) +)) )) β -*++ *)) ! ! -, γ ! ! -. ' ! - & '' ' ! β $ )) β ! $ ,) ) β4( & % ! -( #- / β # 0 β ! ! %! ! " ! ! ! # 2 # ! -, ! γ ! ' ! -+( , $ , $$ 1 ,,(( -. 1 4% 1 / ) 5 ,( $$$ 3+*), . $ 9)/* 6 # ! $ 7 1 $ .* 6 # ! $ 71$ , ( 8 # " , β # 0 β ! ' %! ! ! ' ! -+( - 6 # ! $ ! " % 2 $ & '' ' ! '# ! " ! : + ,/ -( , ! $ $$ " $$$ %! < 2 $1 ! , %! $ = $$ $ 1 2 ; ))* $ ,) ,. β # 0 $ % && && ! ! %! # # # $ $ $ $$ $$ $$ # # # %! && < 7 ? 1 ! #- / 7 7 2 2 2 2 ! ' ! -+( $ 2 ;) $ 2 ; ), 3 5 ,, / ( 3 )( + ) 1 % ,/ . $ ! 9 < ,+ * ) $ 8 @ ! 7 1 9. //( $ > .*) $$ ; ,) ( & $ ) + () (+ & $$ ) + () (* & $$ )++.+/)) $$ " )), '# < 6 # ! $ ! !%! ( $$ 6 # ! $$ 6 # ! $$$ "" )), " % % )), "" )), " % % = ! 1.5 25s 1 R/Rmean Cont 1.5 25s 1 R/Rmean βgal R/Rmean APP 1.5 1 25s ! @ !# & % !% % ! @ !# & % !% GG-OH 1.3 1.2 340 / 380 1.1 1 0.9 0.8 0.7 0.6 0.5 0.4 0.3 0 50 100 150 200 Time (s) 250 300 350 400 % ' ! ! ! !@! # ! 4% ? @@ GG-OH