Rev. sci. tech. Off. int. Epiz., 2014, 33 (3), ... - ... The equine arteritis virus isolate from the 2010 Argentinian outbreak This paper (No. 22102014-00048-EN) has been peer-reviewed, accepted, edited, and corrected by authors. It has not yet been formatted for printing. It will be published in December 2014 in issue 33-3 of the Scientific and Technical Review G.E. Metz (1, 2), M.S. Serena M.G. Echeverría (1, 2)* (3) , C.J. Panei (2, 3) , E.O. Nosetto (1) & (1) Virology, Faculty of Veterinary Sciences, National University of La Plata, 60 and 118, CC 296, 1900 La Plata, Argentina (2) Members of CONICET-CCT (Consejo Nacional de Investigaciones Científicas y Técnicas – Centro Científico Tecnológico), La Plata, Argentina (Scientific Research Council) (3) Immunology, Faculty of Veterinary Sciences, National University of La Plata, 60 and 118, CC 296, 1900 La Plata, Argentina * Corresponding author: [email protected]; [email protected] Summary A semen sample from a stallion infected during the 2010 equine arteritis virus (EAV) outbreak was received for viral isolation prior to castration of the animal. The virus was identified using a polyclonal antibody immunofluorescence test. Reverse-transcription polymerase chain reaction (RT-PCR) was used to amplify a region of the GP5 gene with primers GL105F and GL673R. The PCR products were purified and sequences of both strands were determined in a MegaBACETM 1000 with inner primers CR2 and EAV32. A phylogenetic dataset was built with the previously reported sequences of five strains isolated in Argentina, together with a group of selected sequences obtained from GenBank. The unrooted neighbour-joining tree was constructed using molecular evolutionary genetic analysis (MEGA) and bootstrap analyses were conducted using 1,000 replicate datasets. Evolutionary distances were computed using the maximum No. 22102014-00048-EN 1/18 Rev. sci. tech. Off. int. Epiz., 33 (3) 2 composite likelihood method. A NetNGlyc server analysis at the Technical University of Denmark (www.cbs.dtu.dk/services/NetNGlyc/) was used to predict Nglycosylation in GP5 sequences. The phylogenetic analysis revealed that the new strain (GLD-LP-ARG), together with other strains previously isolated, belongs to the European group EU-1 but in a different branch. The new strain shows 99% nucleotide identity with strain A1 and 98.1% with the Belgian strain 08P178. Persistently infected stallions and their cryopreserved semen constitute a reservoir of EAV, which ensures its persistence in the horse population around the world. These findings reinforce the importance of careful monitoring of persistently infected stallions, as well as semen straws, by RT-PCR or test mating, in accordance with national regulations. Keywords Argentina – Equine arteritis virus – Outbreak – Semen sample. Introduction Equine arteritis virus (EAV) was first isolated from fetal lung tissue during an outbreak of respiratory disease and abortion in Bucyrus, Ohio, in the United Stated of America (USA) (1). Until 2010, the prevalence of EAV-infected stallions resident in Argentina was thought to be very low. The first report of serological evidence was in 1984 (2), when a prevalence of 9.2% was found in the population of warmblood horses sampled. The virus (strain LP01) was first isolated in 2001 (3); later, strain LT-LP-ARG was isolated from the testicle of a seropositive stallion that had been imported into Argentina in 1998 (4). In 1998, several EAV antibody-positive animals were detected in two sport-horse breeding farms that practised artificial insemination with imported semen. A follow-up study between July 2001 and December 2003 found a prevalence of 45.8% in one of those farms; three stallions were virus isolation-positive (strains LP02/R, LP02/C, LP02/P) (5). Three new sequences of EAV from three archive semen samples were obtained in 2008: one (RO-LP-ARG) from a stallion housed on the breeding farm where the first strain of EAV was isolated and the other two (RZ-LP-ARG, KB-LP-ARG) from the farm No. 22102014-00048-EN 2/18 Rev. sci. tech. Off. int. Epiz., 33 (3) 3 where the LP02 strains had been isolated (6). Before the 2010 occurrence of equine viral arteritis in Argentina, the virus had not been involved in respiratory disease, abortion or foal death; the prevalence was restricted to sport-horse breeds and to certain breed lineages (7). Phylogenetic investigations of the virus have focused on the hypervariable region of the GP5 gene, in both European and North American strains (8, 9, 10). At present, Argentinian EAV strains all belong to the same group (6, 11, 12). Although infrequently reported in the past, confirmed outbreaks of arteritis appear to be on the increase and in the past decade the disease has been reported in the USA (13), France (14) and Belgium (15). Analysis of phylogenetic relationships has been demonstrated to be an effective tool in tracing the source of EAV infection. In 2010, two mares on a thoroughbred breeding farm in Buenos Aires Province seroconverted after insemination with frozen semen imported from the Netherlands. The semen straws from the stallion believed to be responsible for spreading the infection were submitted to the Virology Laboratory, National Institute of Agricultural Technology, Castelar, Buenos Aires, and EAV was isolated (16). Four other farms that had used this semen were put into quarantine and all the mares that had been inseminated with the infective semen were found to be seropositive. A high prevalence of EAV infection was also found at an equestrian club located in central Buenos Aires, where two other mares had been inseminated with infective semen from a stallion housed at the club. Respiratory disease, fever, limb oedema and abortions were observed during this outbreak. Twenty-seven jumping stallions seroconverted and 22 persistently infected stallions were castrated. In the present study, the ORF5 region of this EAV strain was analysed genetically and compared with sequences of other strains from Argentina and elsewhere. No. 22102014-00048-EN 3/18 Rev. sci. tech. Off. int. Epiz., 33 (3) 4 Materials and methods Sample processing and virological methodology The infected stallion at the equestrian club in central Buenos Aires was a Hannoverian born in 2000 that had been housed at the club since 2006; the horse was found to be seropositive in May 2010. Before castration of the animal, a semen sample was processed for routine virus isolation at the Virology Laboratory, Faculty of Veterinary Sciences, National University of La Plata, as described previously (3, 17). Briefly, serial tenfold dilutions (10–1 to 10–3) of the sample were inoculated in duplicate onto RK13 cells grown in 6-well plates. The cells were maintained in culture medium containing 2% fetal bovine serum. Plates were incubated at 37°C in an atmosphere of 5% CO2 and examined daily for cytopathic effects. The virus was identified using a polyclonal antibody immunofluorescence test, as described previously (3). Reverse-transcription polymerase chain reaction and sequencing Viral RNA was extracted from 500 µl of the supernatant of infected RK13 cells with 500 µl of TRIzol® (Invitrogen) and precipitated with isopropanol. Portions (5 µl) of RNA resuspended in distilled water were used for cDNA synthesis using reverse transcriptase and random hexamers (Promega). For PCR amplification, the primers GL105F and GL673R, which flank a 546-nt region of the GP5 gene, were used (18). Denaturation, annealing and extension consisted of 35 cycles at 94°C for 45 s, 60°C for 1 min and 72°C for 90 s, respectively. The PCR products were run on 2% agarose gels, stained with ethidium bromide, observed under UV light and purified using a PCR purification kit. The sequences of both strands were determined in a MegaBACETM 1000 with primers CR2 and EAV32, which flank a 519-nt region (8). No. 22102014-00048-EN 4/18 Rev. sci. tech. Off. int. Epiz., 33 (3) 5 Dataset and phylogenetic analysis The phylogenetic dataset was built with five strains isolated in Argentina, sequences reported previously (3, 4, 5, 6, 11), and a group of selected sequences obtained from GenBank (Table I). Sequences were edited using BioEdit software version 5 (19) and aligned in molecular evolutionary genetic analysis (MEGA) software, version 4.0, using the ClustalW algorithm. Sequence pair distances were calculated by DNAstar® (20). The unrooted neighbour-joining tree was constructed using MEGA and bootstrap analyses were conducted using 1,000 replicate datasets. Evolutionary distances were computed using the maximum composite likelihood method (20). Analysis of N-glycosylation sites A NetNGlyc server analysis at the Technical University of Denmark (www.cbs.dtu.dk/services/NetNGlyc/) was used to predict Nglycosylation in GP5 sequences. This program predicts asparagines to be N-glycosylated according to the Asn-Xaa-Ser/Thr sequons (where Xaa is not Pro), with a threshold of 0.5. Results Viral isolation and reverse-transcription polymerase chain reaction After two passages in confluent monolayers of RK13 cells, cytopathic effects were observed in cells inoculated with the seminal plasma at 10–1 and 10–2 dilutions when compared with control cells. The isolated virus strain was named GLD-LP-ARG. After reverse transcription, cDNA was obtained from the supernatants of the cultures. An immunofluorescence test confirmed the presence of EAV antigen; no virus-specific fluorescence was observed in control mock-infected cells. Using primers specific for the GP5 gene, the cDNA gave a visible 591-bp band in an ethidium bromide-stained agarose gel. No bands were observed in the negative control used in the PCR. The 519-bp sequence was analysed and aligned with the Argentinian EAV No. 22102014-00048-EN 5/18 Rev. sci. tech. Off. int. Epiz., 33 (3) 6 isolates and sequences previously reported, and also with American and European reference strains. Phylogenetic analysis The partial nucleotide sequence data for gene GP5 reported here have been previously submitted to GenBank under accession number JQ316510. The distance tree obtained by the neighbour-joining algorithm showed that all the Argentinian sequences, except for the first isolate (LP01), are clustered together with high bootstrap values. However, the new isolate, GLD-LP-ARG, is closely related to strains P1, R1, A1, G1, H20, H22, F23 and 08P178, with LP01 as the most basal strain of EAV in the EU-1 subgroup (Fig. 1). Use of other algorithms such as maximum likelihood revealed the same topology: one group comprises the LP02 strains (LP02/R, LP02/C, LP02/P), LTLP-ARG, RZ-LP-ARG, RO-LP-ARG and KB-LP-ARG; another comprises some European strains and GLD-LP-ARG, with the LP01 strain being the most basal of the group (Fig. 1). The percentage identity among the EAV sequences from the EU-1 clade where the Argentinian strains are located varied between 87.8% and 100%. Strain GLD-LP-ARG shares 99% nucleotide identity with strain A1 and 98.1% with the Belgian strain 08P178. Analysis of N-glycosylation sites Changes in GP5 in the Argentinian sequences are described below. The deduced amino acid sequences (51–222) of the variable and conservative regions of the protein are illustrated in Fig. 2. There are no deletions or insertions. In the first constant region (C1), the only substitution that was found had already been reported (position 57 Cys x Trp in strain LP02/R) (12). The second constant region (C2) remained invariable in all the sequences and the third constant region (C3) showed only substitution in KB-LP-ARG (position 199 Ala x Thr). Analysis of the V1 region (amino acids 61–121) showed that Cys in positions 63, 66 and 80 remained invariable in all the Argentinian sequences. As previously reported (12), neutralising site C (amino acids 67–90) was hypervariable. However, one change (position 70 Asp x Ser) was new for sequences in the 2010 outbreak No. 22102014-00048-EN 6/18 Rev. sci. tech. Off. int. Epiz., 33 (3) 7 strain (GLD-LP-ARG). In contrast, Asp x Glu (position 71) appeared in both GLD-LP-ARG and LP01 (the first strain isolated in Argentina), and Glu x Gly (position 93) appeared in KB-LP-ARG. Regarding amino acids 81–84, when analysing the putative N-linked glycosylation sites, all the sequences showed asparagine sites at amino acid 81 (variable) and in position 56 (conserved and critical for virus infectivity). It has been reported that loss of glycosylation sites in other arteriviruses can alter the virulence and tropism of the virus but it is not known whether these changes play an analogous role in EAV (21). However, according to the prediction glycosylation program used here, the asparagines present in position 81 were not sufficient to glycosylate in strains LP01 and LP02/P. Discussion Most EAV strains belong to one of three large genetic groups (EAV-1, EAV-2, EAV-3) (18). This classification has been modified recently as a North American clade (NA, formerly EAV-2) and a European clade (EU) with two subgroups (EU-1 and EU-2, formerly EAV-1 and EAV-3 respectively) (21). This approach has also been used to construct the phylogeny of isolates in Poland (22), where 44 isolates are included in the European subgroups (EAV-1 or EAV-3). The new Argentinian strain shares similarity with several European phylogenetic strains such as H20 and H22 (Hungary), F23 (France) and 08P178, the last strain isolated from an outbreak in Belgium, as well as with P1, R1, A1 and G1 isolated in the USA (15). Strain S-113 from the Netherlands belongs to the North American group. To date, none of the Argentinian strains has been linked to the North American EAV strains. Differences are mostly localised in the V1 region, in particular within the neutralisation sites B, C and D. As previously reported, South African donkey isolates were classified in subgroup EU-2 but formed only one cluster (21). Furthermore, six isolates from Lipizzaner stallions in South Africa belonged to subgroup EU-1 and did not cluster with the South African asinine strains, thus representing a unique variant (21). As expected, some sequences, such as H21, SWZ64, S3 and S4, did not form statistically supported No. 22102014-00048-EN 7/18 Rev. sci. tech. Off. int. Epiz., 33 (3) 8 clusters and therefore formed an unclassifiable group of highly variable sequences branching off near the centre. According to data from the Argentinian authorities, EAV was isolated from the imported semen of a stallion in the Netherlands. Some Argentinian premises were infected as a consequence of using the infective semen or through the movement of infected horses without observation of clinical signs after spread of the virus via the respiratory route. In the present study, a stallion housed in an equestrian club was castrated because it was persistently infected and shedding the virus in semen. The prevalence of infection at the club was very high (80%). The genetic characterisation reported here confirms that the strain from the 2010 Argentinian outbreak belongs to subgroup EU-1, together with all the Argentinian sequences reported to date. Previously, all Argentinian isolates were related to a non-pathogenic strain and this is the first report of an EAV isolate associated with clinical signs in Argentina. Regarding virulence, EAV strains can be classified as velogenic, mesogenic or lentogenic, according to the clinical signs (23): velogenic strains cause fatal disease in adult horses, mesogenic strains cause less severe disease and lentogenic strains do not cause any clinical signs. Loss of virulence in EAV has been related to the amino acids sequences of structural and nonstructural proteins, and eight critical amino acid substitutions in the structural protein GP5 have been identified as being responsible for EAV attenuation (23). The same amino acid substitutions were observed in the present study when comparing velogenic and mesogenic strains (23). Although the amino acid substitutions of the 2010 EAV Argentinian isolate related to a high- or medium-virulence strain, analysis of strain virulence is more complex; GP5 analysis alone provides an approximation, but analysis of other structural and nonstructural proteins is required. Further, host genetic factors such as the haplotype of the equine could determine resistance or susceptibility to EAV infection and thus influence the capability of the virus to generate clinical signs (24). No. 22102014-00048-EN 8/18 Rev. sci. tech. Off. int. Epiz., 33 (3) 9 In summary, the EAV-infected equine population in Argentina in 2010 showed mild clinical signs that could be correlated by analysing the sequence of gene GP5. Using amino acid substitution, the 2010 isolate was grouped with velogenic or mesogenic strains (23). According to the phylogenetic study, this strain has high similarity with the Belgian strain 08P178, also reported as a European subtype of low virulence (25). The Belgian strain was used recently in an experimental infection in naïve ponies (26) where it produced mild clinical signs when compared with North American strains (27). It was concluded that the differences in clinical signs may be dependent on both the viral strain and the breed of animal (26). Stallions and their cryopreserved semen constitute a reservoir of EAV, thus ensuring persistence of the virus in the horse population around the world and causing new outbreaks such as that in Argentina in 2010. These findings reinforce the importance of careful monitoring of EAV in persistently infected stallions, as well as in semen straws, by RT-PCR or test mating, according to national regulations. Although most EAV strains are of low virulence, outbreaks with severe clinical signs may occur. Conclusion The new Argentinian strain shows 99% nucleotide identity with strain A1 and 98.1% with the Belgian strain 08P178. Acknowledgements The assistance of Ms A. Conde and Mr C. Leguizamon is very gratefully acknowledged. References 1. Doll E.R., Bryans J.T., McCollum W.H. & Crowe M.E.W. (1957). – Isolation of a filterable agent causing arteritis of horses and abortion in mares; its differentiation from the equine abortion (influenza) virus. Cornell Vet., 47 (1), 3–41. No. 22102014-00048-EN 9/18 Rev. sci. tech. Off. int. Epiz., 33 (3) 10 2. Nosetto E.O., Etcheverrigaray M.E., Oliva G.A., González E.T. & Samus S.A. (1984). – Equine viral arteritis: detection of antibodies of horses in Argentina. Zentralbl. Veterinärmed., B, 31 (7), 526–529. 3. Echeverría M.G., Pecoraro M.R., Galosi C.M., Etcheverriagaray M.E. & Nosetto E.O. (2003). – The first isolation of equine arteritis virus in Argentina. Rev. sci. tech. Off. int. Epiz., 22 (3), 1029–1033. 4. Metz G.E., Serena M.S., Ocampos G.M., Panei C.J., Fernández V.L. & Echeverría M.G. (2008). – Equine arteritis virus: a new isolate from the presumable first carrier stallion in Argentina and its genetic relationships among the four reported unique strains. Arch. Virol., 153 (11), 2111–2115. 5. Echeverría M.G., Díaz S., Metz G.E., Serena M.S., Panei C.J. & Nosetto E.O. (2007). – Genetic typing of equine arteritis virus isolates from Argentina. Virus Genes, 35 (2), 313–320. 6. Metz G.E., Serena M.S., Díaz S. & Echeverría M.G. (2008). – Caracterización de secuencias del virus de la arteritis equina obtenidas directamente de muestras de semen de equinos seropositivos. Analecta Veterinaria, 28 (2), 21–26. 7. Vissani A., Iglesias M., Echeverría M.G., Tordoya S., La Torre J., Metz G., Becerra L., Serena S., Olguin Perglione C. & Barrandeguy M. (2008). – Equine viral arteritis: current status in Argentina. Second International Workshop on Equine Viral Arteritis 13–15 October 2008, Lexington, Kentucky. 8. Stadejek T., Bjorklund H., Ros Bascunana C., Ciabatti I.M., Scicluna M.T., Amaddeo D., McCollum W.H., Autorino G.L., Timoney P.J., Paton D.J., Klingeborn B. & Belak S. (1999). – Genetic diversity of equine arteritis virus. J. Gen. Virol., 80 (3), 691–699. 9. Larsen L.E., Storgaard T. & Holm E. (2001). – Phylogenetic characterization of the GL sequences of equine arteritis virus isolated No. 22102014-00048-EN 10/18 Rev. sci. tech. Off. int. Epiz., 33 (3) 11 from semen of asymptomatic stallions and fatal cases of equine viral arteritis in Denmark. Vet. Microbiol., 80 (4), 339–346. 10. Hornyak A., Bakonyi T., Tekes G., Szeredi L. & Rusvai M. (2005). – A novel subgroup among genotypes of equine arteritis virus: genetic comparison of 40 strains. J. vet. med. Sci. B, 52 (3), 1–7. 11. Metz G.E., Ocampos G.P., Serena M.S., Gambaro S.E., Nosetto E. & Echeverría M.G. (2011). – Extended phylogeny of the equine arteritis virus sequences including South American sequences. Intervirology, 54 (1), 30–36. 12. Echeverría M.G., Díaz S., Metz G.E., Serena M.S., Panei C.J. & Nosetto E. (2010). – Evaluation of neutralization patterns of the five unique Argentine equine arteritis virus field strains reported. Rev. argent. Microbiol., 42 (1), 11–17. 13. Zhang J., Timoney P., Shuck K., Seoul G., Go Y., Lu Z., Powell D.G., Meade B.J. & Balasuriya U.B. (2010). – Molecular epidemiology and genetic characterization of equine arteritis virus isolates associated with the 2006–2007 multi-state disease occurrence in the USA. J. gen. Virol., 91 (9), 2286–2301. 14. Pronost S., Pitel P.H., Miszczak F., Legrand L., MarcillaudPitel C., Hamon M., Tapprest J., Balasuriya U.B., Freymuth F. & Fortier G. (2010). – Description of the first recorded major occurrence of equine viral arteritis in France. Equine vet. J., 42 (8), 713–720. 15. Gryspeerdt A., Chiers K., Govaere J., Vercauteren G., Ducatelle R., Van de Walle G.R. & Nauwynck H.J. (2009). – Neonatal foal death due to infection with equine arteritis virus in Belgium. Vlaams diergeneesk. Tijdschr., 78, 189–193. 16. Olguin Perglione C., Córdoba M., Echeverría M.G., Timoney P., Tordoya S., Darqui F., Metz G.E., Miño S., Becerra L., Serena M.S., Vissani A., González E.T., Silvestrini M.P., Corva S., Uncal L., Dayraut J., Badaracco A. & Barrandeguy M. (2010). – Equine viral arteritis outbreak in Argentina. In Proc. 114th Annual No. 22102014-00048-EN 11/18 Rev. sci. tech. Off. int. Epiz., 33 (3) 12 Meeting of the United States Animal Health Association, 12–16 November, Minneapolis, Minnesota. 17. Timoney P.J., McCollum W.H. & Roberts A.W. (1987). – Detection of the carrier state in stallions persistently infected with equine arteritis virus. Proc. Am. Assoc. Equine Pract, 32, 57–65. 18. Mittelholzer C., Stadejek T., Johansson I., Baule C., Ciabatti I., Hannant D., Paton D., Autorino G.L., Nowotny N. & Belak S. (2006). – Extended phylogeny of equine arteritis virus: division into new subgroups. J. vet. Med., B, 53 (2), 55–58. 19. Hall T.A. (1999). – BioEdit: a user friendly biological sequences alignment editor and analysis program for Windows 95/98/NT. Nucl. Acids Symp. Ser., 41, 95–98. 20. Tamura K., Dudley J., Nei M. & Kumar S. (2007). – MEGA4: molecular evolutionary genetic analysis (MEGA) software version 4.0. Molec. Biol. Evol., 24 (8), 1596–1599. 21. Zhang J., Miszczak F., Pronost S., Fortier C., Balasuriya U.B., Zientara S., Fortier G. & Timoney P.J. (2007). – Genetic variation and phylogenetic analysis of 22 French isolates of equine arteritis virus. Arch. Virol., 152 (11), 1977–1994. 22. Larska M. & Rola J. (2008). – Molecular epizootiology of equine arteritis virus isolates from Poland. Vet. Microbiol., 127 (3–4), 392–398. 23. Zhang J., Go Y.Y., MacLachlan N.J., Meade B.J., Timoney P.J. & Balasuriya U.B.R. (2008). – Amino acid substitutions in the structural or nonstructural proteins of a vaccine strain of equine arteritis virus are associated with its attenuation. Virology, 378 (2), 355–362. 24. Balasuriya U.B.R., Go Y.Y. & MacLachlan N.J. (2013). – Equine arteritis virus. Vet. Microbiol., 167 (1–2), 93–122. No. 22102014-00048-EN 12/18 Rev. sci. tech. Off. int. Epiz., 33 (3) 13 25. Vairo S., Vandekerckhove A., Steukers L., Glorieux S., Van den Broeck W. & Nauwynck H. (2012). – Clinical and virological outcome of an infection with the Belgian equine arteritis virus strain 08P178. Vet. Microbiol., 157 (3–4), 333–344. 26. Vairo S., Saey V., Bombardi C., Ducatelle R. & Nauwynck H. (2014). – The recent European isolate (08P178) of equine arteritis virus causes inflammation but not arteritis in experimentally infected ponies. J. comp. Pathol. doi:10.1016/j.jcpa.2014.04.008. 27. Del Piero F. (2000). – Equine viral arteritis. Vet. Pathol., 37 (4), 287–296. __________ No. 22102014-00048-EN 13/18 Rev. sci. tech. Off. int. Epiz., 33 (3) 14 Table I Origins, names and phylogenetic groups of the equine arteritis virus strains used in this study Country of isolation GenBank accession no. Phylogenetic group F5 France EF492543 NA F6 France EF492544 NA F7 France EF492545 NA F8 France EF492546 NA F9 France EF492547 EU-1 F10 France EF492548 EU-2 F11 France EF492549 NA F12 France EF492550 NA F13 France EF492551 NA F14 France EF492552 NA F15 France EF492553 EU-2 F23 France EF492561 EU-1 F24 France EF492562 NA F25 France EF492563 NA F26 France EF492564 NA H20 Hungary AY453305 EU-1 H21 Hungary AY453306 EU-1 H22 Hungary AY453307 EU-1 H23 Hungary AY453308 EU-1 H24 Hungary AY453309 EU-2 I13 Italy AY453310 EU-1 I14 Italy AY453311 NA I15 Italy AY453312 NA I16 Italy AY453313 EU-1 I17 Italy AY453314 EU-1 I18 Italy AY453315 EU-1 I19 Italy AY453316 NA I20 Italy AY453317 EU-1 PLA00-1 Poland EF102348 EU-1 PLB01-1 Poland EF102349 EU-1 PLG02-1 Poland EF102354 EU-1 PLK02-8 Poland EF102363 EU-1 Virus strain PLH05-1 Poland EF102355 EU-1 J25-941109-3 South Africa AY956603 EU-2 J7-931125 South Africa AY956602 EU-2 J6-940309 South Africa AY956601 EU-2 No. 22102014-00048-EN 14/18 Rev. sci. tech. Off. int. Epiz., 33 (3) 15 J5-940309 South Africa AY956600 EU-2 J4-931209 South Africa AY956599 EU-2 J3-931209 South Africa AY956598 EU-2 J2-931125 South Africa AY956597 EU-2 J1-931125 South Africa AY956596 EU-2 RSA1 South Africa AY453332 EU-2 RSA2 South Africa AY453333 NA RSA3 South Africa AY453334 EU-1 RSA4 South Africa AY453335 EU-1 RSA5 South Africa AY453336 EU-1 RSA6 South Africa AY453337 EU-1 RSA7 South Africa AY453338 EU-1 RSA8 South Africa AY453339 EU-1 S2 Sweden AY453340 EU-2 S3 Sweden AY453341 EU S4 Sweden AY453342 EU S5 Sweden AY453343 EU-2 S6 Sweden AY453344 EU-2 S7 Sweden AY453345 EU-2 S-113 Holland AF099833 NA S-544 New Zealand AF099834 NA SWZ64 Switzerland U38609 EU KY84 USA AF107279 NA KY93 USA U81017 NA VBS53 USA U81013 NA D84 USA AF107266 NA E85 USA AF107275 NA G1 USA AF118777 EU-1 P1 USA AF118775 EU-1 R1 USA AF118773 EU-1 A1 USA AF118769 EU-1 MT89 USA U38604 NA 08P178 Belgium JN254761 EU-1 LP01 Argentina DQ435439 EU-1 LP02/R Argentina DQ435440 EU-1 LP02/C Argentina DQ435441 EU-1 LP02/P Argentina DQ435442 EU-1 LT-LP-ARG Argentina EU622859 EU-1 KB-LP-ARG Argentina EU622860 EU-1 RZ-LP-ARG Argentina EU622861 EU-1 RO-LP-ARG Argentina EU622862 EU-1 GLD-LP-ARG Argentina JQ316510 EU-1 No. 22102014-00048-EN 15/18 Rev. sci. tech. Off. int. Epiz., 33 (3) 16 Fig. 1 Maximum likelihood phylogenetic tree based on analysis of ORF5 nucleotide sequences in equine arteritis virus strains Bootstrapping of the tree was carried out in 1,000 duplicates using the MEGA 4.0 software program EU-1 No. 22102014-00048-EN 16/18 Rev. sci. tech. Off. int. Epiz., 33 (3) No. 22102014-00048-EN 17 17/18 Rev. sci. tech. Off. int. Epiz., 33 (3) 18 Fig. 2 Alignment of deduced amino acids for partial GP5 sequences in Argentinian equine arteritis virus strains Non-consensus amino acids are in bold letters. Variable and conserved regions are indicated with capital letters. Neutralisation sites B, C and D are indicated in boxes. Predicted N-glycosylation sites are underlined Neut. Site B Neut. Site C ____ _________________________ C1 RO-LP-ARG KB-LP-ARG LT-LP-ARG LP02/R RZ-LP-ARG LP02/C LP02/P GLD-LP-ARG LP01 51 HTALYNCSAS HTALYNCSAS HTALYNCSAS HTALYNWSAS HTALYNCSAS HTALYNCSAS HTALYNCSAS HTALYNCSAS HTALYNCSAS ****** *** V1 C2 KTCWYCEFLDDQIITFGTGCNDTYSVPVSTVLEQAHGPYSVLFDDMPPFIYYGREFGIFVM KTCWYCEFLDDQIITFGTGCNDTYSVPVSTVLGQAHGPYSVLFDDMPPFIYYGREFGIFVM KTCWYCEFLDDQIITFGTGCNDTYSVPVSTVLEQAHGPYSVLFDDMPPFIYYGREFGIFVM KTCWYCEFLDDQIITFGTGCNDTYSVPVSTVLEQAHGPYSVLFDDMPPFIYYGREFGIFVM KTCWYCEFLDDQIITFGTGCNGTYSVPVSTVLEQAHGPYSVLFDDMPPFIYYGREFGIFVM KTCWYCVFLDDQIITFGTGCNDTHSVPVSTVLEQAHGPYSVLFDDMPPFIYYGREFGIFVM KTCWYCEFLDDQIITFGTGCNNTHSVPVSTVLEQAHGPYSVLFDDMPPFIYYGREFGIFVM KTCWYCEFLSEQIITFGTGCNDTYSVPVSTVLEQAHGPYSVLFDDMPPFIYYGREFGIFVM ETCWYCVFLDEQVITFGTGCNNTYSVPVSTVLEQAHGPYSVLFDDMPPFIYYGREFGIFVM :***** **.:*:********.*:******** **************************** V2 RO-LP-ARG KB-LP-ARG LT-LP-ARG LP02/R RZ-LP-ARG LP02/C LP02/P GLD-LP-ARG LP01 Neut. Site D __________ ATLILEMCVSILFVVYGLYSGAYLAMGIFATTLVVHSV ATLILEMCVSILFVVYGLYSGAYLAMGIFATTLVVHSV ATLILEMCVSILFVVYGLYSGAYLAMGIFATTLVVHSV ATLILEMCVSILFVVYGLYSGAYLAMGIFATTLVVHSV ATLILEMCVSILFVVYGLYSGAYLAMGIFATTLVVHSV ATLILEMCVSILFVVYGLYSGAYLAMGIFATTLVVHSV ATLILEMCVSILFVVYGLYSGAYLAMGIFATTLVVHSV ATLILEMCVSILFVVYGLYSGAYLAMGIFATTLVVHSV VTLILEMCVSILFVVYGLYSGAYLAMGIFATTLVVHSV .************************************* No. 22102014-00048-EN C3 DVFMFYPVLVLFFLSVLPY DVFMFYPVLVLFFLSVLPY DVFMFYPVLVLFFLSVLPY DVFMFYPVLVLFFLSVLPY DVFMFYPVLVLFFLSVLPY DVFMFYPVLVLFFLSVLPY DVFMFYPVLVLFFLSVLPY DVFMFYPVLVLFFLSVLPY DVFMFYPVLVLFFLSVLPY ******************* V3 VVLRQLLWLCLAWRYRCTLHASF VVLRQLLWLCLAWRYRCTLHTSF VVLRQLLWLCLAWRYRCTLHASF VVLRQLLWLCLAWRYRCTLHASF VVLRQLLWLCLAWRYRCTLHASF VVLRQLLWLCLAWRYRCTLHASF VVLRQLLWLCLAWRYRCTLHASF VVLRQLLWLCLAWRYRCTLHASF VVLRQLLWLCLAWRYRCTLHASF ********************:** ISAEGKIYPVDPGLPIAAAGN ISAERKIYPVDPGLPIAAAGN ISAEGKIYPVDPGLPIAAAGN ISAEGKIYPVDPGLPIAAAGN ISAEGKIYPVDPGLPIAAAGN ISAEGKIYPVDPGLPIAAAGN ISAEGKIYPVDPGLPIAAAGN ISAEGKIYPVDPGLPIAAAGN ISAEGKIYPVDPGLPIAAAGN **** **************** 18/18 222 222 222 222 222 222 222 222 222